DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdia3 and CaBP1

DIOPT Version :9

Sequence 1:NP_031978.2 Gene:Pdia3 / 14827 MGIID:95834 Length:505 Species:Mus musculus
Sequence 2:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster


Alignment Length:496 Identity:107/496 - (21%)
Similarity:162/496 - (32%) Gaps:240/496 - (48%)


- Green bases have known domain annotations that are detailed below.


Mouse    14 LLLA------SARLAAASDVLELTDENFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAAT 72
            ||||      ||..:.:..|:|||..||:..|....:  :.:|||:|||||||:.|.|||:..|.
  Fly     8 LLLAFVVGSVSAFYSPSDGVVELTPSNFDREVLKDDA--IWVVEFYAPWCGHCQSLVPEYKKLAK 70

Mouse    73 RLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGA-YDGPRTADGIVSHLKKQAGPAS 136
            .|||:|.:..|:..|::....::||.|:||:|||...:::.. |:|.|||..|.           
  Fly    71 ALKGVVKVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAIA----------- 124

Mouse   137 VPLRTEEEFKKFISDKDASVVGFFRDLFSDGHSEFLKAASNLRDNYRFAHTNIESLVKEYDDNGE 201
                                                                 |:.:.|      
  Fly   125 -----------------------------------------------------EAALAE------ 130

Mouse   202 GITIFRPLHLANKFEDKTVAYTEKKMTSGKIKKFIQDSIFGLCPHMTEDNKDLIQGKDLLTAYYD 266
                                          :||.:|..:.|                        
  Fly   131 ------------------------------VKKKVQGVLGG------------------------ 141

Mouse   267 VDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTTGEVPVVAIRTA 331
                  ..||                                   |..|..|::|:..:      
  Fly   142 ------GGGS-----------------------------------SSGGSGSSSGDDVI------ 159

Mouse   332 KGEKFVMQEEFSRDGKALEQFLQEYFDGNLKRYLKSEPIPESNEGPVKVVVAENFDDIVNEEDKD 396
                     |.:.|                                       |||.:|...|..
  Fly   160 ---------ELTED---------------------------------------NFDKLVLNSDDI 176

Mouse   397 VLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATAN-DVPSPYEVKGFPTIYFSPANK 460
            .|:||:||||||||||.|::.:..::|.  ..:.:..:||||: ...:.|.|:|:|||.|.||..
  Fly   177 WLVEFFAPWCGHCKNLAPEWAKAAKELK--GKVKLGALDATAHQSKAAEYNVRGYPTIKFFPAGS 239

Mouse   461 KLT--PKKYEGGRELNDFISYL-QREATNPP------IIQE 492
            |..  .::|:|||..:|.:|:. .:...|.|      ||.|
  Fly   240 KRASDAQEYDGGRTASDIVSWASDKHVANVPAPELIEIINE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdia3NP_031978.2 ER_PDI_fam 26..487 CDD:273457 96/465 (21%)
Thioredoxin 27..131 CDD:278513 42/104 (40%)
PDI_b_ERp57 135..240 CDD:239367 5/104 (5%)
PDI_b'_ERp72_ERp57 244..357 CDD:239371 8/112 (7%)
PDI_a_PDI_a'_C 377..480 CDD:239293 40/105 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 484..505 5/15 (33%)
Prevents secretion from ER. /evidence=ECO:0000250 502..505
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 38/94 (40%)
PDI_a_P5 157..262 CDD:239299 42/160 (26%)
Thioredoxin_6 190..383 CDD:290560 30/93 (32%)
P5_C 271..400 CDD:239281 3/10 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.