DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIRAS1 and RHB1

DIOPT Version :9

Sequence 1:XP_011526015.1 Gene:DIRAS1 / 148252 HGNCID:19127 Length:232 Species:Homo sapiens
Sequence 2:NP_009956.2 Gene:RHB1 / 850392 SGDID:S000000622 Length:209 Species:Saccharomyces cerevisiae


Alignment Length:205 Identity:63/205 - (30%)
Similarity:108/205 - (52%) Gaps:28/205 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    43 RVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQR 107
            ::.:.||..|||::|.:|||:..|.::|.||||:.:.::|......|||:|.||.|..:...:..
Yeast    18 KIALIGARNVGKTTLTVRFVESRFVESYYPTIENEFTRIIPYKSHDCTLEILDTAGQDEVSLLNI 82

Human   108 LSISKGHAFILVFSVTSKQSLEELGPIY--KLIVQIKGSVEDIPVMLVGNKCD------ETQREV 164
            .|::.....||.:|:.::.|. :|.||.  ||:.|:  ..:::||:|||.|.|      ..:|.|
Yeast    83 KSLTGVRGIILCYSIINRASF-DLIPILWDKLVDQL--GKDNLPVILVGTKADLGRSTKGVKRCV 144

Human   165 DTREAQAVA-------QEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRT 222
            ...|.:.:|       :..:.||:|.||:::|||:|.|..||....|...:|.:|.:.:      
Yeast   145 TKAEGEKLASTIGSQDKRNQAAFIECSAELDYNVEETFMLLLKQMERVEGTLGLDAENN------ 203

Human   223 DRVKGKCTLM 232
                .||::|
Yeast   204 ----NKCSIM 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIRAS1XP_011526015.1 PTZ00369 39..232 CDD:240385 62/203 (31%)
P-loop_NTPase 41..202 CDD:304359 57/173 (33%)
RHB1NP_009956.2 RheB 16..209 CDD:206709 62/203 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.