DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZNRF4 and RKR1

DIOPT Version :9

Sequence 1:NP_859061.3 Gene:ZNRF4 / 148066 HGNCID:17726 Length:429 Species:Homo sapiens
Sequence 2:NP_013975.1 Gene:RKR1 / 855289 SGDID:S000004861 Length:1562 Species:Saccharomyces cerevisiae


Alignment Length:51 Identity:15/51 - (29%)
Similarity:24/51 - (47%) Gaps:4/51 - (7%)


- Green bases have known domain annotations that are detailed below.


Human   309 CAICLDEYEEGDQ---LKILP-CSHTYHCKCIDPWFSQAPRRSCPVCKQSV 355
            ||||.......|:   .|..| |.:.:|..|:..||..:...:||:|:..:
Yeast  1508 CAICYSILHAVDRKLPSKTCPTCKNKFHGACLYKWFRSSGNNTCPLCRSEI 1558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZNRF4NP_859061.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..67
PA_C_RZF_like 86..244 CDD:239038
zf-RING_2 307..352 CDD:290367 14/46 (30%)
RKR1NP_013975.1 COG5219 1..1561 CDD:227544 15/51 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.