powered by:
Protein Alignment ZNRF4 and RKR1
DIOPT Version :9
Sequence 1: | NP_859061.3 |
Gene: | ZNRF4 / 148066 |
HGNCID: | 17726 |
Length: | 429 |
Species: | Homo sapiens |
Sequence 2: | NP_013975.1 |
Gene: | RKR1 / 855289 |
SGDID: | S000004861 |
Length: | 1562 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 51 |
Identity: | 15/51 - (29%) |
Similarity: | 24/51 - (47%) |
Gaps: | 4/51 - (7%) |
- Green bases have known domain annotations that are detailed below.
Human 309 CAICLDEYEEGDQ---LKILP-CSHTYHCKCIDPWFSQAPRRSCPVCKQSV 355
||||.......|: .|..| |.:.:|..|:..||..:...:||:|:..:
Yeast 1508 CAICYSILHAVDRKLPSKTCPTCKNKFHGACLYKWFRSSGNNTCPLCRSEI 1558
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.