DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZNRF4 and rnf128

DIOPT Version :9

Sequence 1:NP_859061.3 Gene:ZNRF4 / 148066 HGNCID:17726 Length:429 Species:Homo sapiens
Sequence 2:XP_012824820.2 Gene:rnf128 / 100145171 XenbaseID:XB-GENE-877067 Length:403 Species:Xenopus tropicalis


Alignment Length:407 Identity:92/407 - (22%)
Similarity:156/407 - (38%) Gaps:99/407 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    74 PRPGRALVAVKALLVLSLLQVPAQAVVRA-----VLEDNSSSVDFADLPALFGVPLAPEGIRGYL 133
            ||.......:.|||:|:|....|..:..|     .:.||.:..:..:: .:||.....|...|.:
 Frog     7 PRQFLPFPCLPALLLLNLSLTGADTLWTANVNYSYVYDNRTYGEEGEI-GVFGQDSPIERAAGLV 70

Human   134 MEVKPA---NACHP---IEAPRLGNRSLGAIVLIRRYDCTFDLKVLNAQRAGFEAAIVHNVHSD- 191
            :..|..   .||..   ...|...|....|::| |...|||..|:..|...|..|.:|:|...| 
 Frog    71 VLPKSERTFTACKDNTNFSVPHNWNGPWIALIL-RGGGCTFTEKINRAAERGARAVVVYNNGMDN 134

Human   192 DLVSMTHVYEDLRGQIAIPSVFVSEAASQDLRVILGCNKSAHALLLPDDPPCHDLGCHPVLTV-- 254
            ::..|:|  ...:..:||  :..:...::.:.||.|                   |...::.:  
 Frog   135 EVFEMSH--PGTKDTVAI--MIGNIKGNEIVEVIKG-------------------GMQVMMVIEV 176

Human   255 -----SWVLGCTLALVVSAFFVLN------------HLWLWAQACCSHRRPVKTSTCQ---KAQV 299
                 ||:...::..|..:||::.            ..|...:|.....:.:|....:   |.|:
 Frog   177 GRKHGSWINHYSIFFVSVSFFIVTAATVGYFIFYSARRWRLTRAQNKKMKQLKAEAKKAIGKLQL 241

Human   300 RTFTW-------HNDLCAICLDEYEEGDQLKILPCSHTYHCKCIDPWFSQAPRRSCPVCK----Q 353
            ||...       ..|.||:|::.|:..|.::||.|:|.:|..|||||..:  .|:||:||    :
 Frog   242 RTIKQGDKVLGPDGDSCAVCIEPYKPSDVVRILTCNHFFHKNCIDPWLLE--HRTCPMCKCDILK 304

Human   354 SVAATEDSFDSTTYSFRDEDPSLPG--HRPPIWAIQVQLRSRRLELLGRAS-------------- 402
            |:...||..::|:.:.    ||:..  .|..:..|:.:.|| .:...|.||              
 Frog   305 SLGIAEDEEETTSAAI----PSVSSELQRSTVQTIEEENRS-EMASSGYASVRGGDEPVDEGQHI 364

Human   403 ------PHCHCSTTSLE 413
                  .|...|.||:|
 Frog   365 YENTELVHNEASATSIE 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZNRF4NP_859061.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..67
PA_C_RZF_like 86..244 CDD:239038 37/169 (22%)
zf-RING_2 307..352 CDD:290367 19/44 (43%)
rnf128XP_012824820.2 PA_GRAIL_like 38..174 CDD:239037 32/160 (20%)
COG5540 <208..302 CDD:227827 28/95 (29%)
RING-H2_RNF128_like 256..304 CDD:319716 21/49 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.