DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gria1 and Ir7f

DIOPT Version :9

Sequence 1:NP_001106796.1 Gene:Gria1 / 14799 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_001138177.1 Gene:Ir7f / 7354418 FlyBaseID:FBgn0259188 Length:621 Species:Drosophila melanogaster


Alignment Length:256 Identity:45/256 - (17%)
Similarity:100/256 - (39%) Gaps:50/256 - (19%)


- Green bases have known domain annotations that are detailed below.


Mouse   411 VTTILEDPYVML----KKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVS-----DGKYGA 466
            |.|..:.|:|.|    |.|      ..|..|:.::|...:|:.:.:|  ||:|:     ...|..
  Fly   231 VLTWHQPPFVELVWDPKHN------RSRGSGFEIQLVEHLARRMNFS--LELVNIALLRPNAYRL 287

Mouse   467 RDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF 531
            .:..::   |.:.:|:....::::.....|..|.:::.....:.|..: :.:.:.::.:.|..:.
  Fly   288 AEGSSE---GPIEKLLQRNVNISMGYFRKTARRNQLLTTPMSYYSANL-VAVLQLERYRIGSLAL 348

Mouse   532 L-DPLAYEIWMCIVFA---YIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLW 592
            | .|....:||.::.|   ::|:               |......|.::...      |....:.
  Fly   349 LVFPFELSVWMLLLLALLIHLGI---------------HLPSARRGNEEDGG------GGLQVVA 392

Mouse   593 FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL 653
            ..|||.:.:    .|||...|.:...|.:.::.:..||.:.|...:.::...:|..|.:.|
  Fly   393 LLLGAALAR----LPRSWRHRFIAAHWLWASIPLRISYQSLLFHLIRLQLYNTPSFSLDQL 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385
ANF_receptor 37..372 CDD:279440
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 45/256 (18%)
Glutamate binding. /evidence=ECO:0000250 492..494 0/1 (0%)
Lig_chan 538..817 CDD:278489 21/119 (18%)
Glutamate binding. /evidence=ECO:0000250 668..669
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 857..881
PDZ-binding 904..907
Ir7fNP_001138177.1 Periplasmic_Binding_Protein_Type_2 231..>358 CDD:304360 24/138 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.