DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gria1 and Ir7a

DIOPT Version :9

Sequence 1:NP_001106796.1 Gene:Gria1 / 14799 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_572406.1 Gene:Ir7a / 31686 FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster


Alignment Length:168 Identity:35/168 - (20%)
Similarity:64/168 - (38%) Gaps:56/168 - (33%)


- Green bases have known domain annotations that are detailed below.


Mouse   151 ADRGLSVLQRVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQ 215
            |:| |.||:.:..|..  .:..:.|.:||...:|..:::      ..||:.:||:   |:..| :
  Fly   137 AER-LQVLRDISRTCV--RFHTSNVILLTEKRDGVVLVY------AYRLLNMDCD---LSVNL-E 188

Mouse   216 IVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPARIMQQW---------- 270
            ::.:.|||:..|                   |.....|..|......|.::  .|          
  Fly   189 LIDIYKNGLFRH-------------------GHEARSFNRVLSLSGCPLQV--SWYPLPPFVSFI 232

Mouse   271 -RTSDARDHTRVDWKRPKYTSALT-YDG--VKVMAEAF 304
             .:||..:..:: |:       || .||  :|::|..|
  Fly   233 GNSSDPEERAQI-WR-------LTGIDGELIKLLASIF 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 35/168 (21%)
ANF_receptor 37..372 CDD:279440 35/168 (21%)
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447
Glutamate binding. /evidence=ECO:0000250 492..494
Lig_chan 538..817 CDD:278489
Glutamate binding. /evidence=ECO:0000250 668..669
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 857..881
PDZ-binding 904..907
Ir7aNP_572406.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.