Sequence 1: | NP_001307300.2 | Gene: | ZNF582 / 147948 | HGNCID: | 26421 | Length: | 517 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_011306.1 | Gene: | MIG2 / 852663 | SGDID: | S000003177 | Length: | 382 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 65 | Identity: | 27/65 - (41%) |
---|---|---|---|
Similarity: | 39/65 - (60%) | Gaps: | 2/65 - (3%) |
- Green bases have known domain annotations that are detailed below.
Human 281 KPYQCKECGKAFNRISHLKVHYRIHTGEKPYAC--KECGKTFSHRSQLIQHQTVHTGRKLYECKE 343
Human 344 343 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ZNF582 | NP_001307300.2 | None | |||
MIG2 | NP_011306.1 | COG5048 | 1..381 | CDD:227381 | 27/65 (42%) |
C2H2 Zn finger | 19..39 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 47..69 | CDD:275368 | 8/21 (38%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |