DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZNF582 and CG31441

DIOPT Version :9

Sequence 1:NP_001307300.2 Gene:ZNF582 / 147948 HGNCID:26421 Length:517 Species:Homo sapiens
Sequence 2:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster


Alignment Length:370 Identity:87/370 - (23%)
Similarity:156/370 - (42%) Gaps:101/370 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    87 ELFPKQHVYEVESPQWEIMESLTSYGLE---------CSSFQDDWECRNQFDRQQGNPDRHFHQM 142
            :||.|.:.:.:     .|:|::|...||         |..      |:.|.||            
  Fly    24 KLFNKSNYHFI-----SILENITDMYLEFDTTLPHLICQC------CKVQLDR------------ 65

Human   143 IIRHEEMPTFDQHASLTFYQK---IHTR-------------------EKPFGYNKCRKDFWQKEL 185
                          .|||..|   :|..                   :|| ...|.::|.|.   
  Fly    66 --------------ILTFRNKCLEVHKSFMAANRKLLRKKAIVDEELDKP-DVEKLQQDLWD--- 112

Human   186 LINHQGIYTNEKPYKCKECGKAFKYGSRLIQHENIHSGKKPYECKECGKAFNSGSNFIQHQRVHT 250
                   :|::      |...|....:.|::.::..:.|    .|:...|..:..|..:..:|.|
  Fly   113 -------HTDQ------EMCVAMADTAGLLREDHNDNEK----AKDAEDATQNEKNQEEQVQVQT 160

Human   251 GEKPYECKDCEKAFSRSSQLIE------HQRTHTGEKPYQCKECGKAFNRISHLKVHYRIHTGEK 309
                .|.:.|::.....|.:.:      .:||....|.:.|.:||..|...::||:|.:.|:|.|
  Fly   161 ----EEVEHCQEQLHNMSIISKGVSARVPKRTKRNSKSWFCDQCGGVFKSSTYLKLHLQRHSGHK 221

Human   310 PYACKECGKTFSHRSQLIQHQTVHTGRKLYECKECGKAFNQGSTLIRHQRIHTGEKPYECKVCGK 374
            |:||..|...:...:::.:|:.:||..:.|.|:.|.|.:...|:.:.|:|.||.|:|::|:.|.|
  Fly   222 PFACDICQAKYYTDNEMRRHRILHTDARPYACRFCSKTYRGCSSKVVHERTHTNERPFQCQHCDK 286

Human   375 AFRVSSQLKQHQRIHTGEKPYQCKVCGRAFKRVSHLTVHY--RIH 417
            ||..:|..::|:.:||.::.|.|::|.:.|.|.||||:|.  ::|
  Fly   287 AFTSTSTRQKHEMLHTNQRKYHCEICDQWFLRSSHLTLHQSTKLH 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZNF582NP_001307300.2 None
CG31441NP_731558.1 zf-AD 7..82 CDD:285071 18/94 (19%)
COG5048 <174..337 CDD:227381 52/158 (33%)
C2H2 Zn finger 197..217 CDD:275370 7/19 (37%)
C2H2 Zn finger 225..245 CDD:275368 3/19 (16%)
C2H2 Zn finger 253..273 CDD:275368 6/19 (32%)
zf-H2C2_2 268..290 CDD:290200 11/21 (52%)
C2H2 Zn finger 281..301 CDD:275368 7/19 (37%)
C2H2 Zn finger 309..328 CDD:275368 9/18 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.