DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZNF784 and CG31441

DIOPT Version :9

Sequence 1:NP_976308.1 Gene:ZNF784 / 147808 HGNCID:33111 Length:323 Species:Homo sapiens
Sequence 2:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster


Alignment Length:174 Identity:52/174 - (29%)
Similarity:72/174 - (41%) Gaps:39/174 - (22%)


- Green bases have known domain annotations that are detailed below.


Human   103 CHVCGHSCPGPASLRAHYSLHTGERPYRCALCPRAFKALAPLLRHQHRHGVEPGTSRRPPDTAAV 167
            |..||........|:.|...|:|.:|:.|.:|...:.....:.||:..|            |.| 
  Fly   197 CDQCGGVFKSSTYLKLHLQRHSGHKPFACDICQAKYYTDNEMRRHRILH------------TDA- 248

Human   168 AEQRPGVAPERAEVVMAAAAAGAAVGKPFACRFCAKPFRRSSDMRDHERVHTGERPYHCGICGKG 232
                                      :|:|||||:|.:|..|....|||.||.|||:.|..|.|.
  Fly   249 --------------------------RPYACRFCSKTYRGCSSKVVHERTHTNERPFQCQHCDKA 287

Human   233 FTQSSVLSGHARIHTGERPFRCTLCDRTFNNSSNFRKHQRTHFH 276
            ||.:|....|..:||.:|.:.|.:||:.|..||:...||.|..|
  Fly   288 FTSTSTRQKHEMLHTNQRKYHCEICDQWFLRSSHLTLHQSTKLH 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZNF784NP_976308.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
C2H2 Zn finger 67..87 CDD:275368
C2H2 Zn finger 103..123 CDD:275368 5/19 (26%)
C2H2 Zn finger 131..151 CDD:275368 4/19 (21%)
COG5048 <194..276 CDD:227381 36/81 (44%)
C2H2 Zn finger 198..218 CDD:275368 10/19 (53%)
C2H2 Zn finger 226..246 CDD:275368 7/19 (37%)
C2H2 Zn finger 254..274 CDD:275368 8/19 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 269..323 4/8 (50%)
CG31441NP_731558.1 zf-AD 7..82 CDD:285071
COG5048 <174..337 CDD:227381 52/174 (30%)
C2H2 Zn finger 197..217 CDD:275370 5/19 (26%)
C2H2 Zn finger 225..245 CDD:275368 4/19 (21%)
C2H2 Zn finger 253..273 CDD:275368 10/19 (53%)
zf-H2C2_2 268..290 CDD:290200 12/21 (57%)
C2H2 Zn finger 281..301 CDD:275368 7/19 (37%)
C2H2 Zn finger 309..328 CDD:275368 8/18 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4797
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.