DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZNF784 and CG10959

DIOPT Version :10

Sequence 1:NP_976308.1 Gene:ZNF784 / 147808 HGNCID:33111 Length:323 Species:Homo sapiens
Sequence 2:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster


Alignment Length:216 Identity:55/216 - (25%)
Similarity:81/216 - (37%) Gaps:49/216 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    61 EPGSFHCALCPAAFRLVSELLFHEHGHLAGAEGGGQGGDPSRC--HVCGHSCPGPASLRAHYSLH 123
            |...|.|.||...|:....||.|..||        .|....:|  ..||.|.....:|.:|..:|
  Fly   252 EHTEFACQLCDKVFKSSRSLLRHVQGH--------SGARTFKCEHENCGKSFVNQHNLTSHRRVH 308

Human   124 TGERPYRCALCPRAFKALAPLLRHQHRHGVEPGTSRRPPDTAAVAEQRPGVAPERAEVVMAAAAA 188
            :.||.|.|.||....:....|:.|:..|..|                                  
  Fly   309 SEERNYVCELCGYRSRYREALIVHRRTHTGE---------------------------------- 339

Human   189 GAAVGKPFACRFCAKPFRRSSDMRDHERVHTGERPYHCGICGKGFTQSSVLSGHARIHTGERPFR 253
                 |||.|:.||:.|...|.:.:|:.:|:.|:||.|..|...|::...|..|..:|.|.:.|:
  Fly   340 -----KPFQCQTCARRFASKSLLNEHQAMHSTEKPYKCDKCDSAFSRPKALYHHKHLHLGIKKFK 399

Human   254 CTLCDRTFNNSSNFRKHQRTH 274
            |.:|...:..::....|.|.|
  Fly   400 CKICGNAYAQAAGLSAHMRAH 420

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
ZNF784NP_976308.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
C2H2 Zn finger 67..87 CDD:275368 7/19 (37%)
C2H2 Zn finger 103..123 CDD:275368 6/21 (29%)
C2H2 Zn finger 131..151 CDD:275368 5/19 (26%)
COG5048 <194..276 CDD:227381 26/81 (32%)
C2H2 Zn finger 198..218 CDD:275368 6/19 (32%)
C2H2 Zn finger 226..246 CDD:275368 5/19 (26%)
zf-C2H2 252..274 CDD:395048 5/21 (24%)
C2H2 Zn finger 254..274 CDD:275368 4/19 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 269..323 3/6 (50%)