DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSTF2 and Rbfox1

DIOPT Version :9

Sequence 1:NP_001293135.1 Gene:CSTF2 / 1478 HGNCID:2484 Length:597 Species:Homo sapiens
Sequence 2:NP_001246707.1 Gene:Rbfox1 / 39198 FlyBaseID:FBgn0052062 Length:962 Species:Drosophila melanogaster


Alignment Length:432 Identity:79/432 - (18%)
Similarity:139/432 - (32%) Gaps:115/432 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    16 RSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGR 80
            :.:.|.|||:...:..|:.:|.:.|.::...:::: |.|. ||:||..:.:...|..|...|:|.
  Fly   460 KRLHVSNIPFRFRDPDLRAMFGQFGTILDVEIIFN-ERGS-KGFGFVTFANSNDAERARERLHGT 522

Human    81 EFSGRALRVDNAASEKNKEEL---------KSLGTGAPVI------------------------- 111
            ...||.:.|:||.:....:::         |.....||.:                         
  Fly   523 VVEGRKIEVNNATARVQTKKVTAVPNVVLTKDGAIPAPALVCVQWPEAAVAAAMRGVAIQRGHVG 587

Human   112 ---ESPYGETISPEDAPESISKAVASLPPEQMFEL--------------MKQMKLCVQNSPQEA- 158
               .:||.....|...|..::.:.|:...:|..:|              .:|.:..||...|:. 
  Fly   588 VVGATPYHHPHHPHHHPALLAASAAAAQQQQQRQLAAAAVATAAVAQQQQQQQQAVVQQQQQQVA 652

Human   159 ----RNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHRQTN----------IPTLIAGNPQP-V 208
                :....|..|...|:.|.|.|.:        :..|:|..          :....|....| :
  Fly   653 AAAQQQHQQQQQQQQQAVQQQQAVQQ--------QQQHQQQQQQQQQQQHAAVAAAAAAASHPHM 709

Human   209 HGAGPGSGSNVSMNQQNPQAPQAQSLGGMHVNGAPPLMQASMQGGVPAPGQMP----AAVTGPGP 269
            |.|    .::...:...||..|.|::...........:|.|:...:..|...|    ||......
  Fly   710 HAA----HAHAHAHALGPQLAQLQAVAVPTAASNAAALQQSLAAAIQNPSGNPNAAAAAAAYAAR 770

Human   270 GSLAPGGGMQAQVGMPGSGPVSME------------RGQGTLQHSP----VGPAGP-----ASIE 313
            .|.|.|.....|.....:...||.            .|...:.:.|    ...|.|     |:..
  Fly   771 LSAATGATQSPQTAAAAAAAASMAASANAANNAAALHGFAPVYYDPFLAAAASADPNLRFQAAKP 835

Human   314 RVQVPMQDPRAAMQRGSLPA---------NVPTPRGLLGDAP 346
            ..:||...|.|.:.|.::..         .:|.|:.:|..||
  Fly   836 VTEVPAAQPAAILNRRTVTTLNSNPHTINRIPVPQNVLATAP 877

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSTF2NP_001293135.1 PABP-1234 4..352 CDD:130689 79/432 (18%)
RRM_CSTF2_CSTF2T 18..92 CDD:241115 20/73 (27%)
CSTF2_hinge 112..191 CDD:373015 17/97 (18%)
PRK14718 <412..>469 CDD:173181
CSTF_C 553..593 CDD:373006
Rbfox1NP_001246707.1 RRM <454..>542 CDD:223796 22/83 (27%)
RRM_FOX1_like 460..535 CDD:240853 21/76 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.