DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSTF2 and CG10466

DIOPT Version :9

Sequence 1:NP_001293135.1 Gene:CSTF2 / 1478 HGNCID:2484 Length:597 Species:Homo sapiens
Sequence 2:NP_001260601.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster


Alignment Length:83 Identity:36/83 - (43%)
Similarity:50/83 - (60%) Gaps:0/83 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    18 VFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREF 82
            :||...||..||..|..:||:.|.||:..|:.|.:|||.||:.|..|:||.:.:.|:.||||.:.
  Fly    36 IFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKI 100

Human    83 SGRALRVDNAASEKNKEE 100
            ..|.||||:.|..|..:|
  Fly   101 LDRTLRVDHVADYKPPKE 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSTF2NP_001293135.1 PABP-1234 4..352 CDD:130689 36/83 (43%)
RRM_CSTF2_CSTF2T 18..92 CDD:241115 33/73 (45%)
CSTF2_hinge 112..191 CDD:373015
PRK14718 <412..>469 CDD:173181
CSTF_C 553..593 CDD:373006
CG10466NP_001260601.1 RRM_ist3_like 25..113 CDD:240857 34/76 (45%)
RRM <36..>126 CDD:223796 36/83 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.