DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HIPK4 and mbk-1

DIOPT Version :9

Sequence 1:XP_006723099.1 Gene:HIPK4 / 147746 HGNCID:19007 Length:619 Species:Homo sapiens
Sequence 2:NP_510460.2 Gene:mbk-1 / 181578 WormBaseID:WBGene00003149 Length:882 Species:Caenorhabditis elegans


Alignment Length:412 Identity:139/412 - (33%)
Similarity:205/412 - (49%) Gaps:41/412 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    17 LGKGTFGEVAKGWRRSTGEMVAIKILKNDAYRNRIIKNELKLLHCMRGLDPEEAHVIRFLE--FF 79
            :|||:||:|.|.:.....|.|||||:||........:.|:.||......|.:..:.|..|:  |.
 Worm   334 VGKGSFGQVTKAYDTLNKEEVAIKIIKNKKTFFDQAQIEIHLLELTNAHDKDNKYNIVTLKGHFV 398

Human    80 HDALKFYLVFELLEQNLFEFQKENNFAPLPARHIRTVTLQVLTALARLK--ELAIIHADLKPENI 142
            |.| ...||||||..||::..|..:|..:.....|....|:...|..|.  ||:|||.||||||:
 Worm   399 HRA-HLCLVFELLSYNLYDLLKNTSFRGVSLNLARKFAQQLGKTLLFLSSPELSIIHCDLKPENV 462

Human   143 MLVDQTRCPFRVKVIDFGSASIFSEVRYVKEPYIQSRFYRAPEILLGLPFCEKVDVWSLGCVMAE 207
            :||:..|.  :::||||||:.......|   .||||||||:||:|||:.:..|:|:|||||::.|
 Worm   463 LLVNAKRS--QIRVIDFGSSCQTGHRIY---QYIQSRFYRSPEVLLGIAYDTKIDMWSLGCILVE 522

Human   208 LHLGWPLYPGNNEYDQVRYICETQGLPKPHLLHAACKAHHFFKRNPHPDAANPWQLKSSADYLAE 272
            :|.|.||:.|::|.||:..|.|..|:|...:|....|.|.:|.:...    ..:..|.:.|....
 Worm   523 MHTGEPLFAGSSEVDQMMKIVEVLGMPPKEMLDIGPKTHKYFDKTED----GIYYCKKTRDGYRH 583

Human   273 TKVRPLERRKYMLKSLDQIETVNGGSVASRLTFPDREALAEHADLKSMVELIKRMLTWESHERIS 337
            |...|..|:.:.:     :...:||....||..|....    .|.....:||||||.::..:|||
 Worm   584 TYKAPGARKLHEI-----LGVTSGGPGGRRLGEPGHSV----EDYSKFKDLIKRMLQFDPKQRIS 639

Human   338 PSAALRHPFVSMQQLR--SAHETTH-----YYQLSLR--SYRLSLQVEGKPPTPVVAAEDGTPYY 393
            |...:||||:..::.|  |....:|     ..||.::  |.::| ||...|....|..||...| 
 Worm   640 PYYVVRHPFLKQKEERVPSQPPVSHSNLQQQQQLYIQQPSSQMS-QVMESPSVGSVYVEDNGMY- 702

Human   394 CLAEEKEAAGMGS--VAGSSPF 413
                 ::|.|..:  ::.:|.|
 Worm   703 -----RQAPGSSANPISVTSSF 719

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HIPK4XP_006723099.1 PKc_like 11..347 CDD:304357 120/333 (36%)
S_TKc 11..347 CDD:214567 120/333 (36%)
mbk-1NP_510460.2 PKc_DYRK1 312..651 CDD:271128 121/335 (36%)
S_TKc 326..649 CDD:214567 120/333 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C161462955
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.