DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adgrg1 and mthl1

DIOPT Version :9

Sequence 1:XP_006530743.1 Gene:Adgrg1 / 14766 MGIID:1340051 Length:718 Species:Mus musculus
Sequence 2:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster


Alignment Length:396 Identity:76/396 - (19%)
Similarity:139/396 - (35%) Gaps:102/396 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse   365 QHQPQPKNVTLQCVF------WVEDPASSSTGSWSSAGCETVSRDTQTSCLCNHLTYFAVLMVSS 423
            |.:.:.|.:..|.:|      .:.|  .|..|:...|..:.:.:...|..:...:.:.:..:|:.
  Fly   288 QREGEVKIIACQHLFSSAAGAGIHD--GSIGGTIEQANGQNLQKAVLTGGILVSIVFLSATLVAG 350

Mouse   424 TEVEATHK--HYLTLLSYVGCVISALACVFTIAAYLCSRRKSRDYTIKVHMNLLSAVFLLDVSFL 486
            ..:.|.|.  |:...:.||.|                               ||....||.:..|
  Fly   351 FLLPAVHHALHWRCQICYVTC-------------------------------LLFGKILLAIEEL 384

Mouse   487 LSEPVALTGSEAACRTSAMFLHFSLLACLSWMGLEGYNLYRLVVEVFGTYVPGYLLK-------- 543
            .|   :|....|||.|.|:.:.|..||...|:....:|::    ..|..:.|..|.:        
  Fly   385 SS---SLQPGSAACHTLAITMQFFFLAAFFWLNTMCFNIW----WTFRDFRPSSLERNQEALRRY 442

Mouse   544 -LSIVGWGFPVFLVTLVALVDVNNYGPIILAVRRTPE----RVTYPSM-CWIRD---SLVSYVTN 599
             .|:..||.|:.:..:.|.||            :.||    |..:..: ||..:   |:.:|.  
  Fly   443 LYSLYAWGGPLLITFVAACVD------------QLPETTLLRPGFGQLYCWFDNRNLSIFAYF-- 493

Mouse   600 LGLFSLVFLFNLAMLATMVVQIL-------RLRPHSQNWPHVLTLLGLSLVLGLPWALVFFSFAS 657
            .|...|:...|:|:..:...|:.       .::..|:........|.|.:|:|:.|.....|:..
  Fly   494 YGPIGLLLCANIALFVSTTHQLTCGLWKRDDVKSSSEKSALGRVCLKLVVVMGVTWIADILSWLV 558

Mouse   658 GTFQLVILYLFSIITSFQGFLIFL------WYWS---------MRFQAQGGPSPLKNNSDSAKLP 707
            |. ...:.:...:|.:.||..||:      ..|:         :|.......:.::::|.|..||
  Fly   559 GG-PHGVWFFTDLINALQGVFIFIVVGCQPQVWTACRRIFCPRLRHDITNTTNGVQHSSSSQGLP 622

Mouse   708 ISSGST 713
            ..:|.|
  Fly   623 SMAGGT 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adgrg1XP_006530743.1 PLL 60..193 CDD:376013
GAIN_A 204..251 CDD:376045
GPS 376..419 CDD:366827 7/48 (15%)
7tm_GPCRs 431..698 CDD:391938 58/307 (19%)
TM helix 1 433..458 CDD:341315 3/24 (13%)
TM helix 2 468..490 CDD:341315 6/21 (29%)
TM helix 3 501..528 CDD:341315 7/26 (27%)
TM helix 4 541..561 CDD:341315 5/28 (18%)
TM helix 5 592..621 CDD:341315 6/28 (21%)
TM helix 6 629..656 CDD:341315 6/26 (23%)
TM helix 7 662..687 CDD:341315 6/39 (15%)
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 58/302 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.