DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCBE1 and verm

DIOPT Version :10

Sequence 1:XP_016881046.1 Gene:CCBE1 / 147372 HGNCID:29426 Length:435 Species:Homo sapiens
Sequence 2:NP_001163469.1 Gene:verm / 40149 FlyBaseID:FBgn0261341 Length:555 Species:Drosophila melanogaster


Alignment Length:176 Identity:34/176 - (19%)
Similarity:53/176 - (30%) Gaps:78/176 - (44%)


- Green bases have known domain annotations that are detailed below.


Human    35 YREEPEDGDR-------EICSESKIATTKYPCLKSSGELTTCYR--------------KKCCKGY 78
            |:.:|...|:       |:|::.  ...:|..|::.|:....||              .:|..|.
  Fly    38 YQRKPHGQDKLEGVDVEEVCADR--PADEYFRLETDGDCREVYRCDSAGEDGTWRLAPIRCAGGL 100

Human    79 KF-VLGQ----------C-------------------IPEDYDVCAEAPC---------EQQCTD 104
            .| ||.|          |                   .||....|.:..|         :..|.|
  Fly   101 AFDVLRQLCDWKSNVKSCDVLEKPRKAKPILKTDEPICPEGKLSCGDGECLDKELFCNGKSDCKD 165

Human   105 NFGRVLCTCYPGYRYDRERHRKREKPYCLDIDECA------SSNGT 144
            ......|:      .|.:.:|   .|.| |..:||      |::||
  Fly   166 ESDENACS------VDEDPNR---APEC-DPTQCALPDCFCSADGT 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCBE1XP_016881046.1 EGF_CA 134..175 CDD:214542 6/17 (35%)
vermNP_001163469.1 CBM_14 57..118 CDD:426342 12/62 (19%)
LDLa 138..172 CDD:238060 6/33 (18%)
CE4_CDA_like_1 213..488 CDD:200596
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.