DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCBE1 and CG15446

DIOPT Version :10

Sequence 1:XP_016881046.1 Gene:CCBE1 / 147372 HGNCID:29426 Length:435 Species:Homo sapiens
Sequence 2:NP_608430.2 Gene:CG15446 / 33088 FlyBaseID:FBgn0031155 Length:373 Species:Drosophila melanogaster


Alignment Length:56 Identity:13/56 - (23%)
Similarity:22/56 - (39%) Gaps:8/56 - (14%)


- Green bases have known domain annotations that are detailed below.


Human     5 PPSRGGAAR--GQLGRSLGPLLLLLALGHTWTYREEPEDGDREICSESKIATTKYP 58
            |||...|||  .:..|.:|      .:..:.|..:|.:.|::.:.........|.|
  Fly   118 PPSAATAARMASEFARQVG------GISQSPTIEDEGKSGEQSVMQPKSKKANKMP 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCBE1XP_016881046.1 EGF_CA 134..175 CDD:214542
CG15446NP_608430.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.