DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KRT25 and Ppi1

DIOPT Version :9

Sequence 1:NP_853512.1 Gene:KRT25 / 147183 HGNCID:30839 Length:450 Species:Homo sapiens
Sequence 2:NP_733345.2 Gene:Ppi1 / 43581 FlyBaseID:FBgn0051025 Length:998 Species:Drosophila melanogaster


Alignment Length:335 Identity:59/335 - (17%)
Similarity:102/335 - (30%) Gaps:115/335 - (34%)


- Green bases have known domain annotations that are detailed below.


Human    56 GNTGGGNPCAGFTVNERGLLSGNEKVTMQNLNDRLASYLDSVHALEEANADLEQ----------- 109
            |...||        .|||... |..|.:|:|:....|.:|.......::.::.|           
  Fly   243 GRLAGG--------QERGCFP-NMNVDLQDLSFMSTSSIDPCVGFMPSDTEVAQDSPPCSEDRAQ 298

Human   110 -------------KIKGWYEKFGPGSCRGLDHDYSRYFP------IIDDLKNQIIASTTSNANAV 155
                         .:.|.|..:   ||..:|.|...:.|      .....:..::..  .|||.:
  Fly   299 DSFQCQDSPPRLIDMAGPYPVY---SCPNVDDDCVTFEPPAGPATQFSSCQKNVLGE--GNANRL 358

Human   156 LQ-----------IDNAR---LTADD--------------------FRLKYENELALHQSV---- 182
            .|           |.|.|   |..:|                    |:.:..:|.|..|.:    
  Fly   359 CQKHSSPRLRQMHISNTRSCVLCGEDVSWLPKVAACPCCGYKPVPEFKERPYDEQATAQQILLDH 423

Human   183 -EADVNGLRRVLDEITLCRTDLE--------IQYETLSEEMTYLKKNHKEEMQVLQCAAGGNVNV 238
             |..|..|...:..:..|..:.|        ..:|.:.::...|:::.:|.......:|..|...
  Fly   424 LENPVENLSFDMGSVEGCSANEEHGVPEPTSEAFEAIVKDYQLLRRSIRESNTKATQSATKNPTA 488

Human   239 EMNAAPGVDLTVLLNNMRAEYEALAEQNRRDAEAWFNEKSASLQQQISEDVGATTSA-------- 295
            :..:|...||..:...:|               ..||.|:|...|:| :|:.|...|        
  Fly   489 QEGSAQPQDLAKVFTELR---------------DLFNVKAADENQKI-QDICAEACALAKSHKKS 537

Human   296 RNELTEMKRT 305
            :|.....:||
  Fly   538 KNRPASPERT 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KRT25NP_853512.1 Head. /evidence=ECO:0000255 1..78 6/21 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Filament 78..391 CDD:278467 53/313 (17%)
Coil 1A. /evidence=ECO:0000255 79..114 6/58 (10%)
Linker 1. /evidence=ECO:0000255 115..136 6/26 (23%)
Coil 1B. /evidence=ECO:0000255 137..228 21/137 (15%)
SPEC 173..370 CDD:295325 29/154 (19%)
Linker 12. /evidence=ECO:0000255 229..251 5/21 (24%)
Coil 2. /evidence=ECO:0000255 252..390 13/62 (21%)
Tail. /evidence=ECO:0000255 391..450
Ppi1NP_733345.2 DUF4788 108..>294 CDD:292651 13/59 (22%)
DUF4776 371..848 CDD:292622 35/193 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.