DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC25A10 and CG1907

DIOPT Version :9

Sequence 1:NP_001257882.1 Gene:SLC25A10 / 1468 HGNCID:10980 Length:406 Species:Homo sapiens
Sequence 2:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster


Alignment Length:236 Identity:71/236 - (30%)
Similarity:116/236 - (49%) Gaps:31/236 - (13%)


- Green bases have known domain annotations that are detailed below.


Human     2 AAEARVSRWYFGGLASCGAACCTHPLDLLKVHLQT------QQEVKLRMTGMALRVVRT----DG 56
            |......::.||||:..||.....||||:|..:|.      ::|.:     .:|..::|    :|
  Fly    13 AVATNAIKFLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKKEYR-----SSLHCIQTIVSKEG 72

Human    57 ILALYSGLSASLCRQMTYSLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPAD 121
            .||||.|:.|:|.||.||:..|..:|..:.|...:..|......:.:.:|:::|..|.|:||||:
  Fly    73 PLALYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAE 137

Human   122 LVNVRMQNDVKLPQGQRRNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQL--YCRWM 184
            :..|||.:|.:||..:||||.:..:.|.|:.|||||..|:.|:.....|..:|.:.||  |.::.
  Fly   138 VALVRMTSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFK 202

Human   185 CHVPVPAPGCAEDSPDELQGGVSGRFPLRRGDSEARASGLL 225
            .:.        ...|.:::.|:...|      ..:..||||
  Fly   203 TYF--------RHGPLQMEEGIKLHF------CASMLSGLL 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC25A10NP_001257882.1 Mito_carr 13..93 CDD:278578 29/89 (33%)
Mito_carr 95..179 CDD:278578 29/83 (35%)
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 30/97 (31%)
Mito_carr 118..207 CDD:278578 32/96 (33%)
Mito_carr 219..307 CDD:278578 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.