DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC25A10 and Dic4

DIOPT Version :10

Sequence 1:NP_001257882.1 Gene:SLC25A10 / 1468 HGNCID:10980 Length:406 Species:Homo sapiens
Sequence 2:NP_649054.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster


Alignment Length:178 Identity:69/178 - (38%)
Similarity:103/178 - (57%) Gaps:8/178 - (4%)


- Green bases have known domain annotations that are detailed below.


Human     4 EARVSRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALRVVRTDGILALYSGLSASL 68
            |..:.||:|||.||...|....|:|::|.|:|.|:: |..:.|...|:....|.|..|.|.||::
  Fly    17 EGLLPRWWFGGFASMCVAFAVAPIDIVKTHMQIQRQ-KRSILGTVKRIHSLKGYLGFYDGFSAAI 80

Human    69 CRQMTYSLTRFAIYETVR--DRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDV 131
            .||||.:...|.:|:|.:  :.|.:.|     :..|::||.|:|..|...|.|.||:|||||.|:
  Fly    81 LRQMTSTNIHFIVYDTGKKMEYVDRDS-----YLGKIILGCVAGACGSAFGIPTDLINVRMQTDM 140

Human   132 KLPQGQRRNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQL 179
            |.|..:||||.|..|||.|:.:|||.:.|:.|.::|..:.:|.|..|:
  Fly   141 KEPPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQI 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC25A10NP_001257882.1 Mito_carr 13..93 CDD:395101 28/81 (35%)
Mito_carr 95..179 CDD:395101 35/83 (42%)
Dic4NP_649054.1 Mito_carr 26..100 CDD:395101 27/74 (36%)
Mito_carr 104..201 CDD:395101 37/90 (41%)
Mito_carr 211..292 CDD:395101
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.