DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC25A10 and CG7514

DIOPT Version :10

Sequence 1:NP_001257882.1 Gene:SLC25A10 / 1468 HGNCID:10980 Length:406 Species:Homo sapiens
Sequence 2:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster


Alignment Length:170 Identity:61/170 - (35%)
Similarity:88/170 - (51%) Gaps:4/170 - (2%)


- Green bases have known domain annotations that are detailed below.


Human    13 GGLASCGAACCTHPLDLLKVHLQ---TQQEVKLRMTGMALRVVRTDGILALYSGLSASLCRQMTY 74
            ||||.....|...||||:|..:|   |..|.|.....: |:|.:.:||||||:||||.|.||.||
  Fly    19 GGLAGMLGTCIVQPLDLVKTRMQISATTGEYKSSFDCL-LKVFKNEGILALYNGLSAGLMRQATY 82

Human    75 SLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRR 139
            :..|...|:...|...|....|......:.:|.::|..|...|.||::..:||.:|.:||..:||
  Fly    83 TTARMGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPAEVALIRMMSDNRLPPAERR 147

Human   140 NYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQL 179
            ||...|:...|:.::||:..|:.|......|..:|.:.||
  Fly   148 NYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQL 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC25A10NP_001257882.1 Mito_carr 13..93 CDD:395101 35/82 (43%)
Mito_carr 95..179 CDD:395101 24/83 (29%)
CG7514NP_647923.1 Mito_carr 19..90 CDD:395101 32/71 (45%)
Mito_carr 104..201 CDD:395101 26/84 (31%)
Mito_carr 207..284 CDD:395101
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.