DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC25A10 and CG18327

DIOPT Version :9

Sequence 1:NP_001257882.1 Gene:SLC25A10 / 1468 HGNCID:10980 Length:406 Species:Homo sapiens
Sequence 2:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster


Alignment Length:330 Identity:77/330 - (23%)
Similarity:130/330 - (39%) Gaps:86/330 - (26%)


- Green bases have known domain annotations that are detailed below.


Human     8 SRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLR---------MTGMALRVVRTDGILALYSG 63
            |.:..||:|:.||...|:|::::|..:|.|.|:..|         :....:.|.:.||||.|..|
  Fly     4 SDFVLGGVAAMGAGVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQKG 68

Human    64 LSASLCRQMTYSLTRFAIYETVRDRVAKG----SQGPLPFHEKVLLGSVSGLAGGFVGTPADLVN 124
            |:.:||.|...:..|.:||   ...|.||    ::|.:.|.:.:..|::.|:.|.:..:|..|:.
  Fly    69 LAPALCFQFVINSFRLSIY---THAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASPFFLIK 130

Human   125 VRMQNDV--KLPQGQRRNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQLYCRWMCHV 187
            .::|...  ::..|.:..:|...|.:.::.|:.|:..|:.|:....||..:.:..|:        
  Fly   131 TQLQAQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQI-------- 187

Human   188 PVPAPGCAEDSPDELQGGVSGRFPLRRGDSEARASGLLQGPRPSWHPPHPPHRAHFCVSGTA--- 249
                             .|.|           :|..||:......||.    ...|| ||.|   
  Fly   188 -----------------AVFG-----------QAKSLLKENGVVTHPT----ILSFC-SGLAAGS 219

Human   250 ------------TQKLWHQSAILTSRG---NGWAARPDTLGSSKESQAQH-LLLGPRPPWPWPPV 298
                        |.:|::|......||   .||.   |.:.:...|:..: |..|     .||..
  Fly   220 FVSLAITPLDVVTTRLYNQGVDAQGRGIYYRGWL---DCVLTILRSEGVYGLYKG-----FWPIY 276

Human   299 LRSRP 303
            |||.|
  Fly   277 LRSAP 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC25A10NP_001257882.1 Mito_carr 13..93 CDD:278578 29/92 (32%)
Mito_carr 95..179 CDD:278578 17/85 (20%)
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 25/82 (30%)
PTZ00169 5..293 CDD:240302 76/329 (23%)
Mito_carr 101..201 CDD:278578 23/135 (17%)
Mito_carr 204..296 CDD:278578 24/91 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.