DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gna13 and Galphaq

DIOPT Version :9

Sequence 1:NP_034433.3 Gene:Gna13 / 14674 MGIID:95768 Length:377 Species:Mus musculus
Sequence 2:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster


Alignment Length:404 Identity:163/404 - (40%)
Similarity:233/404 - (57%) Gaps:56/404 - (13%)


- Green bases have known domain annotations that are detailed below.


Mouse    18 CVLTNGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRARE 82
            |.|:....||:|.::||:|.|.|:|...:|.:|:||||.||||||||:||||||||..:....:.
  Fly     3 CCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKR 67

Mouse    83 EFRPTIYSNVIKGMRVLVDAREKLHIPWGDNKNQLHGDKLMAFDTRAPMAAQGMVETRVFLQ--Y 145
            .:...::.|:...|:.::.|.:.|.|.:|..::....|.:|:.|          .||....:  |
  Fly    68 GYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSID----------YETVTTFEDPY 122

Mouse   146 LPAIRALWEDSGIQNAYDRRREFQLGESVKYFLDNLDKLGVP----------------------- 187
            |.||:.||:|:|||..||||||:||.:|.||:|.:||::..|                       
  Fly   123 LNAIKTLWDDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYP 187

Mouse   188 --------------------DYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKR 232
                                ||:|::||||.||.||.||.||.|::..:.|:|||||||||||::
  Fly   188 FDLEEIRFSYLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRK 252

Mouse   233 WFECFDSVTSILFLVSSSEFDQVLMEDRQTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLE 297
            |..||::||||:|||:.||:||:|.|....||:.||..:|.||:....|.|.|:||||||.||||
  Fly   253 WIHCFENVTSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLE 317

Mouse   298 EKVQVVSIKDYFLEFEGDPHCLRDVQKFLVECFRGKRRDQQQRPLYHHFTTAINTENIRLVFRDV 362
            ||:....:.|||.|::|........::|::..|.....| .::.:|.|||.|.:||||:|||..|
  Fly   318 EKIMYSHLVDYFPEYDGPQRDAITAREFILRMFVDLNPD-SEKIIYSHFTCATDTENIKLVFCAV 381

Mouse   363 KDTILHDNLKQLML 376
            ||||:.:.||:..|
  Fly   382 KDTIMQNALKEFNL 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gna13NP_034433.3 G_alpha 29..375 CDD:214595 158/390 (41%)
G-alpha 49..371 CDD:206639 148/366 (40%)
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 50..63 10/12 (83%)
G2 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 195..203 5/7 (71%)
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 218..227 7/8 (88%)
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 287..294 6/6 (100%)
G5 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 347..352 2/4 (50%)
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 148/366 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.