DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gna12 and Galphaq

DIOPT Version :9

Sequence 1:NP_034432.1 Gene:Gna12 / 14673 MGIID:95767 Length:379 Species:Mus musculus
Sequence 2:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster


Alignment Length:412 Identity:153/412 - (37%)
Similarity:224/412 - (54%) Gaps:63/412 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse    11 CLLPAEAGARERRAGAARDAEREARRRSRDIDALLARERRAVRRLVKILLLGAGESGKSTFLKQM 75
            |.|..||              :|.:|.:::|:..|.|::|..||.:|:||||.||||||||:|||
  Fly     3 CCLSEEA--------------KEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQM 53

Mouse    76 RIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPWQHSENEKHGMFLMAFENKAGLPV 140
            |||||..:..:....:...:|.||....:.::.|.|.|.|.:...|:.:....:|:.:.:.    
  Fly    54 RIIHGSGYSDEDKRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYET---- 114

Mouse   141 EPATFQ-LYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIG---------------- 188
             ..||: .|:.|:..||.|:||:|.:.||.|:||.:|.||:|.:|||:.                
  Fly   115 -VTTFEDPYLNAIKTLWDDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRV 178

Mouse   189 ---------------------------QLNYFPSKQDILLARKATKGIVEHDFVIKKIPFKMVDV 226
                                       |.:|.|::||||.||..|.||:|:.|.:..|.|:||||
  Fly   179 PTTGIIEYPFDLEEIRFSYLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDV 243

Mouse   227 GGQRSQRQKWFQCFDGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETIVNNKLFFNVSIIL 291
            |||||:|:||..||:.:|||:|:|:.|||||:|.|....||:.||..:|.||:....|.|.|:||
  Fly   244 GGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVIL 308

Mouse   292 FLNKMDLLVEKVKSVSIKKHFPDFKGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHFTTAIDTEN 356
            ||||.|||.||:....:..:||::.|........:.::::.|.....:..|.::.|||.|.||||
  Fly   309 FLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAITAREFILRMFVDLNPDSEKIIYSHFTCATDTEN 373

Mouse   357 IRFVFHAVKDTILQENLKDIML 378
            |:.||.||||||:|..||:..|
  Fly   374 IKLVFCAVKDTIMQNALKEFNL 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gna12NP_034432.1 G_alpha 40..377 CDD:214595 146/380 (38%)
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 57..70 10/12 (83%)
G2 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 198..206 5/7 (71%)
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 221..230 7/8 (88%)
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 290..297 6/6 (100%)
G5 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 349..354 2/4 (50%)
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 138/360 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.