DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSRP2 and Mlp84B

DIOPT Version :9

Sequence 1:NP_001287894.1 Gene:CSRP2 / 1466 HGNCID:2470 Length:193 Species:Homo sapiens
Sequence 2:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster


Alignment Length:191 Identity:92/191 - (48%)
Similarity:116/191 - (60%) Gaps:20/191 - (10%)


- Green bases have known domain annotations that are detailed below.


Human     9 KCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGY 73
            ||..||::||.|||....|..||:.||.|.:|.|:||||....|:.|:|||:|:|:|:||||||:
  Fly    11 KCPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYCKTCHGRKFGPKGYGF 75

Human    74 GQGAGTLNMDRGERL----GIKPE-----SVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAA 129
            |.|||||:||.|.:.    |..|.     .::|......|.          .|.|.|||..||||
  Fly    76 GTGAGTLSMDNGSQFLRENGDVPSVRNGARLEPRAIARAPE----------GEGCPRCGGYVYAA 130

Human   130 EKIIGAGKPWHKNCFRCAKCGKSLESTTLTE-KEGEIYCKGCYAKNFGPKGFGYGQGAGAL 189
            |:::..|:.|||.||:|..|.|.|:|....| .:..|||||||||.|||||:|||||.|||
  Fly   131 EQMLARGRSWHKECFKCGTCKKGLDSILCCEAPDKNIYCKGCYAKKFGPKGYGYGQGGGAL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSRP2NP_001287894.1 LIM1_CRP2 9..63 CDD:188864 27/53 (51%)
Nuclear localization signal. /evidence=ECO:0000255 64..69 2/4 (50%)
LIM2_CRP2 119..172 CDD:188871 27/53 (51%)
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 26/52 (50%)
LIM_CRP_like 120..173 CDD:188712 26/52 (50%)
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142497
Domainoid 1 1.000 79 1.000 Domainoid score I8660
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H111061
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 1 1.000 - - otm40707
orthoMCL 1 0.900 - - OOG6_104400
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X318
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.610

Return to query results.
Submit another query.