DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ADRA1D and Oamb

DIOPT Version :9

Sequence 1:NP_000669.1 Gene:ADRA1D / 146 HGNCID:280 Length:572 Species:Homo sapiens
Sequence 2:NP_001262774.1 Gene:Oamb / 43982 FlyBaseID:FBgn0024944 Length:751 Species:Drosophila melanogaster


Alignment Length:718 Identity:186/718 - (25%)
Similarity:263/718 - (36%) Gaps:301/718 - (41%)


- Green bases have known domain annotations that are detailed below.


Human    99 VGVFLAAFI-LMAVAGNLLVILSVACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFW 162
            :.:.:..|| ::.:.||.|||.:|.|:..|::|||:|||||||||||:...|||||||.||...|
  Fly    22 ISLAVLEFINVLVIGGNCLVIAAVFCSNKLRSVTNFFIVNLAVADLLVGLAVLPFSATWEVFKVW 86

Human   163 AFGRAFCDVWAAVDVLCCTASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVV 227
            .||..:|.:|.||||..||||||:||.||:||||.|...:.||:||:.:||.:::|.:||::..:
  Fly    87 IFGDLWCRIWLAVDVWMCTASILNLCAISLDRYVAVTRPVTYPSIMSTKKAKSLIAGIWVLSFFI 151

Human   228 SVGPLLGWKE--------------------------------------------PVPP------- 241
            ...||:|||:                                            |.||       
  Fly   152 CFPPLVGWKDQKAVIQPTYPKGNHTLYYTTTMSSSEDGQLGLDSIKDQGEASLPPSPPHIGNGNA 216

Human   242 ----DERF--------------------------------------------------------- 245
                |..|                                                         
  Fly   217 YNPYDPGFAPIDGSAEIRIAAIDSTSTSTTATTTTTASSSSTTETEMDLDLLNAPPQNRPQTISG 281

Human   246 -----CGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERG-------- 297
                 |.:|.:.||.::|::.|||:||.|::..|.|:|..|..|||::..|.|..:|        
  Fly   282 SCPWKCELTNDRGYVLYSALGSFYIPMFVMLFFYWRIYRAAVRTTRAINQGFKTTKGSKGIGSRF 346

Human   298 KASEVVLRIHCRGAAT------------------------------------------------- 313
            :...:.|||| ||..:                                                 
  Fly   347 EEQRLTLRIH-RGRGSNQQDSMHSNGSTQSTTTTLGTPSPERLSKYATRRLHHHDKIKISVSYPS 410

Human   314 ------------------------------GADG-------------AHGMRSA----------- 324
                                          |.:|             .||:.|:           
  Fly   411 SENISELAGHGDVGHERRQSGNALFAVHYNGTNGRESTESQLYRQQQQHGVASSCYLQVGKGLPE 475

Human   325 -------------KGHT-------FRSSLSVRLLKFSREKKAAKTLAIVVGVFVLCWFPFF---F 366
                         .||:       .|.::..::.:|..|.||||||||:||:|:.||.|||   .
  Fly   476 LARRQSNTSEAGGSGHSRPANKKMGRRNIKAQVKRFRMETKAAKTLAIIVGMFIFCWCPFFTMYI 540

Human   367 VLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLL-RCQCRRR------ 424
            :.|    |.|......:|.|:|||||.||.|||:||...|::|:.||.|:: ||.|.|:      
  Fly   541 IRP----FCQDCVDPLLFSVLFWLGYCNSAVNPMIYALFSKDFRFAFKRIICRCFCSRQSVSLKS 601

Human   425 -RRRRPLWRVYGHHWRASTSGLRQDCAPSSGDAPPGAPLALTALPDPDPEPPGTPEMQAPVASRR 488
             ||...:..:   ..||.|..:....|..|..               |.......||..... |.
  Fly   602 SRRGSDMSAI---RIRARTPSITPSAAAHSFG---------------DESELHHSEMSNDPRXRS 648

Human   489 KPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVEAVSLGVPHEVAEG 553
            ..||:..: ..||..|:  |.|:..|..:.|.:      ..|.||  .|.|||.|.|       .
  Fly   649 FGPSSSSQ-SSLGGLRK--TSLKVPVYEICHPL------VMETAC--YSYVEATSDG-------S 695

Human   554 ATC 556
            |:|
  Fly   696 ASC 698

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ADRA1DNP_000669.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..77
7tmA_alpha1D_AR 97..413 CDD:320450 148/565 (26%)
TM helix 1 98..124 CDD:320450 8/25 (32%)
TM helix 2 131..157 CDD:320450 20/25 (80%)
TM helix 3 169..199 CDD:320450 20/29 (69%)
TM helix 4 211..234 CDD:320450 7/22 (32%)
TM helix 5 251..280 CDD:320450 12/28 (43%)
TM helix 6 341..371 CDD:320450 18/32 (56%)
TM helix 7 381..406 CDD:320450 14/24 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 444..488 5/43 (12%)
OambNP_001262774.1 7tm_4 29..>154 CDD:304433 66/124 (53%)
7tm_1 37..>181 CDD:278431 69/143 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1095345at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.