DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NRG4 and Nrg4

DIOPT Version :9

Sequence 1:XP_016877426.1 Gene:NRG4 / 145957 HGNCID:29862 Length:129 Species:Homo sapiens
Sequence 2:NP_114391.1 Gene:Nrg4 / 83961 MGIID:1933833 Length:115 Species:Mus musculus


Alignment Length:111 Identity:85/111 - (76%)
Similarity:96/111 - (86%) Gaps:0/111 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAF 65
            ||||||:||||.|:|||||||:||||||||||||||:||||||||||||||.|||.::|||..||
Mouse     1 MPTDHEQPCGPRHRSFCLNGGICYVIPTIPSPFCRCIENYTGARCEEVFLPSSSIPSESNLSAAF 65

Human    66 VALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHS 111
            |.||||:||.|.|..|||||||.|||||||.:|:||||::|...||
Mouse    66 VVLAVLLTLTIAALCFLCRKGHLQRASSVQCEISLVETNNTRTRHS 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NRG4XP_016877426.1 PHA02887 <9..83 CDD:333467 57/73 (78%)
Nrg4NP_114391.1 PHA03099 <9..84 CDD:165381 58/74 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83960319
Domainoid 1 1.000 98 1.000 Domainoid score I45686
eggNOG 1 0.900 - - E1_2D9WP
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12921
Inparanoid 1 1.050 193 1.000 Inparanoid score I16320
Isobase 00.000 Not matched by this tool.
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG41328
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0013815
OrthoInspector 1 1.000 - - oto122532
orthoMCL 1 0.900 - - OOG6_119370
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11345
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1414.200

Return to query results.
Submit another query.