DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gfi1b and sens

DIOPT Version :9

Sequence 1:NP_001153878.1 Gene:Gfi1b / 14582 MGIID:1276578 Length:363 Species:Mus musculus
Sequence 2:NP_524818.1 Gene:sens / 45328 FlyBaseID:FBgn0002573 Length:541 Species:Drosophila melanogaster


Alignment Length:379 Identity:138/379 - (36%)
Similarity:176/379 - (46%) Gaps:75/379 - (19%)


- Green bases have known domain annotations that are detailed below.


Mouse     7 VKSKKAHTYHQPRAQGDELVWPPAVI---------------PVAKEHSQSASPLLSTPLPSQTLD 56
            :||.......:.|:||: ::|.||.:               ....|......|::          
  Fly   192 LKSSSTPQQQRQRSQGN-IIWSPASMCERSARREQYGLKMEEQGDEEEHQVDPIV---------- 245

Mouse    57 WNTIKQEREMLLNQSLPKMASAPEGPLVTPQPQDGESPLSESPPFYKPSFSWDTLASSYSHSYTQ 121
             ...|.||......||....|:...| .:...||.|..:::.              ..|:|    
  Fly   246 -RKFKYERRTASISSLQSPISSLSAP-ASNAVQDLEFEVAQQ--------------QLYAH---- 290

Mouse   122 TPSTMQSAFLE----RSVRLYGSPLVPSTESP----LDFRLRYSPGMDTYHCVK-CNKVFSTPHG 177
                 :|||:.    .::.|....|...:|.|    ...|::.....|...... .|.|.:...|
  Fly   291 -----RSAFMAGLTGNNLELLTQHLKLKSEQPQQQQQQHRIKDEQQQDNRSAAALMNLVAAAEFG 350

Mouse   178 LEVHVRRSHSGTRPFACDVCGKTFGHAVSLEQHTHVHSQGVPAGSSPTPTLAVPGLEAPPAPDPP 242
               ::|..|...:    ....:...|....:||.|....       |..|.......:..:....
  Fly   351 ---YMRNQHQQPQ----QQQQQQLHHQQQPQQHQHQQQH-------PDSTATDVARRSSSSSSYQ 401

Mouse   243 GP-RFLRQERSFECRMCGKAFKRSSTLSTHLLIHSDTRPYPCQFCGKRFHQKSDMKKHTYIHTGE 306
            |. ...|..|:|:|:.|||:|||||||||||||||||||||||:|||||||||||||||||||||
  Fly   402 GENEEKRSGRNFQCKQCGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTYIHTGE 466

Mouse   307 KPHKCQVCGKAFSQSSNLITHSRKHTGFKPFSCELCTKGFQRKVDLRRHRESQH 360
            |||||.||.||||||||||||.|||||:|||.|.||.:.|||||||||||||:|
  Fly   467 KPHKCTVCLKAFSQSSNLITHMRKHTGYKPFGCHLCDQSFQRKVDLRRHRESRH 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gfi1bNP_001153878.1 C2H2 Zn finger 165..186 CDD:275368 4/21 (19%)
C2H2 Zn finger 194..214 CDD:275368 4/19 (21%)
zf-C2H2 253..275 CDD:278523 17/21 (81%)
C2H2 Zn finger 255..275 CDD:275368 16/19 (84%)
COG5048 263..>340 CDD:227381 70/76 (92%)
C2H2 Zn finger 283..303 CDD:275368 18/19 (95%)
zf-H2C2_2 295..320 CDD:290200 22/24 (92%)
C2H2 Zn finger 311..331 CDD:275368 16/19 (84%)
C2H2 Zn finger 339..356 CDD:275368 12/16 (75%)
sensNP_524818.1 zf-C2H2 413..435 CDD:278523 17/21 (81%)
C2H2 Zn finger 415..435 CDD:275368 16/19 (84%)
COG5048 423..>497 CDD:227381 68/73 (93%)
zf-H2C2_2 428..452 CDD:290200 22/23 (96%)
C2H2 Zn finger 443..463 CDD:275368 18/19 (95%)
zf-H2C2_2 455..480 CDD:290200 22/24 (92%)
C2H2 Zn finger 471..491 CDD:275368 16/19 (84%)
C2H2 Zn finger 499..516 CDD:275368 12/16 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10849
eggNOG 1 0.900 - - E33208_3BCNN
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2452
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2013
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.