DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arhgdig and RhoGDI

DIOPT Version :9

Sequence 1:NP_032139.1 Gene:Arhgdig / 14570 MGIID:108430 Length:225 Species:Mus musculus
Sequence 2:NP_001262080.1 Gene:RhoGDI / 40179 FlyBaseID:FBgn0036921 Length:201 Species:Drosophila melanogaster


Alignment Length:203 Identity:85/203 - (41%)
Similarity:121/203 - (59%) Gaps:9/203 - (4%)


- Green bases have known domain annotations that are detailed below.


Mouse    27 LADKDGESTP---SDEVLDEIVPEYQAPGKKSMLAIWQLDPGDVSLVKYKQALLGPLPP---IMD 85
            :|:.:.:..|   .|:|.|   ..||||.:|::..|...|..|.||.:||:||||....   |::
  Fly     1 MAETETKHHPEHHDDDVHD---ANYQAPPEKTIEEIMAADQEDESLRRYKEALLGAAQTEKIIVE 62

Mouse    86 PSLPNVQVTRLTLLTEQAPGPIIMDLTGDLDALKNQVFVLKEGIEYKVKITFKVNKEIVSGLKCL 150
            |:.|...:.:...|..:....:.:||||||..||.|:||:|||::|||:|.|.|.:|||.|||.:
  Fly    63 PNDPRKVIVKKLALVVEGRDDMELDLTGDLSQLKKQLFVIKEGVQYKVRIDFIVQREIVHGLKYV 127

Mouse   151 HHTYRRGLRVDKAIFMVGSYGPRAQEYEFVTSVEEAPRGALARGLYVVRSLFTDDDRLNHLSWEW 215
            ..|.|.|:.|||...|||||.|:.:...::|..||||.|..:||.|.|.|:|||||:..||.|:|
  Fly   128 QKTSRLGVNVDKMKHMVGSYPPKKEIQFYLTPAEEAPSGTFSRGTYSVSSVFTDDDKHIHLEWDW 192

Mouse   216 HLHVCQDW 223
            ...:.:||
  Fly   193 TFEIKKDW 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArhgdigNP_032139.1 Rho_GDI 42..222 CDD:307981 79/182 (43%)
RhoGDINP_001262080.1 Rho_GDI 14..199 CDD:280310 81/187 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837035
Domainoid 1 1.000 195 1.000 Domainoid score I3138
eggNOG 1 0.900 - - E1_KOG3205
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 199 1.000 Inparanoid score I3780
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54245
OrthoDB 1 1.010 - - D1265661at2759
OrthoFinder 1 1.000 - - FOG0001289
OrthoInspector 1 1.000 - - otm42349
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10980
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2126
SonicParanoid 1 1.000 - - X792
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.900

Return to query results.
Submit another query.