DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gdf5 and scw

DIOPT Version :9

Sequence 1:NP_032135.2 Gene:Gdf5 / 14563 MGIID:95688 Length:495 Species:Mus musculus
Sequence 2:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster


Alignment Length:389 Identity:102/389 - (26%)
Similarity:162/389 - (41%) Gaps:52/389 - (13%)


- Green bases have known domain annotations that are detailed below.


Mouse   120 GQLPGGKASSKAGSAPSSFLLKKTREPGTPREPKEPFRPPPITPHEYMLSLYRTLSDADRKGGNS 184
            |..|..:|.....::.|.|||:...|....:||||...    ..|:..|.....:|:.||:    
  Fly    49 GDRPRRQAEPNLHNSASKFLLEVYNEISEDQEPKEVLH----QRHKRSLDDDILISNEDRQ---- 105

Mouse   185 SVKLEAGLANTITSFIDKGQDDRGPAVRKQRYVFDISALEKD-GLLGAELRILRKKPLDVAKPAV 248
                |....|:|.:|..:.:.::..........|:.:.:..| .|:.|.|||. |:|..|.:.|.
  Fly   106 ----EIASCNSILTFSSRLKPEQLDNELDMHITFNTNDVPVDLSLVQAMLRIY-KQPSLVDRRAN 165

Mouse   249 PSSGRVAQLKLSSCPSGRQPAALLDVRSVPGLDGS-GWEVFDIWKLFRNFKNSAQLC----LELE 308
            .:.....:|      ..||..:...:.||...... ||..|::....|.:.::..|.    |.:.
  Fly   166 FTVSVYRKL------DNRQDFSYRILGSVNTTSSQRGWLEFNLTDTLRYWLHNKGLQRRNELRIS 224

Mouse   309 AWERGRAVDLRGLGFERTARQVHEKALFLVFGRTKKRDLFFNEIKARSGQDDKTVYEYLFSQRRK 373
            ..:...:....||...:.:|...|.  |:| |.....:|.....|.|..:|           ..|
  Fly   225 IGDSQLSTFAAGLVTPQASRTSLEP--FIV-GYFNGPELLVKIQKLRFKRD-----------LEK 275

Mouse   374 RRA--------PLANRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFP 430
            |||        |.......||.::    |.|....|:||::...:|:|||.::||:.|.|.|.||
  Fly   276 RRAGGGSPPPPPPPPVDLYRPPQS----CERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFP 336

Mouse   431 LRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGC 494
            |.:.:..||||::||||:...|. .|..|||||.|..|:||...:.:.:...:|:..|.:.|||
  Fly   337 LGTKMNATNHAIVQTLMHLKQPH-LPKPCCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECGC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gdf5NP_032135.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..162 12/41 (29%)
TGFb_propeptide 139..338 CDD:279078 43/204 (21%)
TGFB 394..495 CDD:214556 41/101 (41%)
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 49/226 (22%)
TGFB 300..400 CDD:214556 41/101 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.