DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gdf11 and scw

DIOPT Version :9

Sequence 1:NP_034402.1 Gene:Gdf11 / 14561 MGIID:1338027 Length:405 Species:Mus musculus
Sequence 2:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster


Alignment Length:370 Identity:86/370 - (23%)
Similarity:136/370 - (36%) Gaps:74/370 - (20%)


- Green bases have known domain annotations that are detailed below.


Mouse    86 RLKEAPNISREVVKQLLPKAPPLQQILD----LHDFQGDALQPEDFL---EEDEYHATTETVISM 143
            |.:..||:.....|.||.....:.:..:    ||.....:|. :|.|   |:.:..|:..::::.
  Fly    53 RRQAEPNLHNSASKFLLEVYNEISEDQEPKEVLHQRHKRSLD-DDILISNEDRQEIASCNSILTF 116

Mouse   144 AQETDPAVQTDGSPLCCHFHFSPK--VMFTKVLKAQLWVYLRP--VPRPATVYLQILRLKPLTGE 204
            :....|. |.| :.|..|..|:..  .:...:::|.|.:|.:|  |.|.|...:.:.|..     
  Fly   117 SSRLKPE-QLD-NELDMHITFNTNDVPVDLSLVQAMLRIYKQPSLVDRRANFTVSVYRKL----- 174

Mouse   205 GTAGGGGGGRRHIRIRSL-KIELHSRSGHWQSIDFKQVLHSWFRQPQSNWGIE------INAFDP 262
                   ..|:....|.| .:...|....|...:....|..|..    |.|::      |:..|.
  Fly   175 -------DNRQDFSYRILGSVNTTSSQRGWLEFNLTDTLRYWLH----NKGLQRRNELRISIGDS 228

Mouse   263 SGTDLAV---------TSLGP-------GAEGLHPFMELRVLENTKRSRRNLGL-------DCDE 304
            ..:..|.         |||.|       |.|.|....:||...:.::.|...|.       ..|.
  Fly   229 QLSTFAAGLVTPQASRTSLEPFIVGYFNGPELLVKIQKLRFKRDLEKRRAGGGSPPPPPPPPVDL 293

Mouse   305 HSSESRCCRYPLTVDF-EAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHT---------HLVQQ 359
            :.....|.|...|||| |....:|:||||:::|.:|.|.|.:....|...|         ||.|.
  Fly   294 YRPPQSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMHLKQP 358

Mouse   360 ANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGC 404
            ..|:    |||.||.:..|.:|.:.::..|...|....|...|||
  Fly   359 HLPK----PCCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECGC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gdf11NP_034402.1 TGFb_propeptide 59..283 CDD:279078 46/230 (20%)
TGFB 311..405 CDD:214556 35/104 (34%)
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 43/219 (20%)
TGFB 300..400 CDD:214556 35/104 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.