DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSNK1E and CG7094

DIOPT Version :9

Sequence 1:NP_001885.1 Gene:CSNK1E / 1454 HGNCID:2453 Length:416 Species:Homo sapiens
Sequence 2:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster


Alignment Length:408 Identity:195/408 - (47%)
Similarity:254/408 - (62%) Gaps:59/408 - (14%)


- Green bases have known domain annotations that are detailed below.


Human     2 ELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIP 66
            :|.:|.||||.:.||||||||||||.:|..|.|||||:|....|:|||..|:|.|:.:....|.|
  Fly    20 KLLIGGKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKYPQLIYEAKVYEQLARCPGFP 84

Human    67 SIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKP 131
            ::...|.|.:||.|||:|||||||:|||.|.|:|||||||:|.||::.|||.:|.:.|||||:||
  Fly    85 TLLHYGCEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQLLMRIECVHERGFIHRDIKP 149

Human   132 DNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDL 196
            |||||||.:..|.:|:|||||:|:|:|..:..|||||.::|||||.||||||..:|:|||||||:
  Fly   150 DNFLMGLDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNLTGTVRYASINAQIGVEQSRRDDM 214

Human   197 ESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYLNFCRSLRFD 261
            ||:.|.|||||||.|||||:.||.|:||||:|.|||.|..|..||||:||||...:.:.|:|.|.
  Fly   215 ESMSYCLMYFNLGKLPWQGITAANKKQKYEKILEKKTSVTIAQLCKGFPSEFCLLMTYVRNLGFK 279

Human   262 DKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGAARNPEDVDRERR---EHEREE---RMGQL 320
            :.||::||||:||.||......|||::||..|:    :..:.:.|.|.   |.||||   |.|: 
  Fly   280 EPPDHTYLRQIFRILFRSLNHHYDYIYDWTALQ----QQKDQICRSREQILESEREEVRKRDGE- 339

Human   321 RGSATRALPPGPPTGATANRLRSAAEPVASTPASRIQPAGNTSPRAISRVDRERKVSM---RLHR 382
            ||                      .||                     :.|:||...:   |||:
  Fly   340 RG----------------------CEP---------------------QRDKERHKDLELDRLHK 361

Human   383 GA--PANVSSSDLTGRQE 398
            .:  .|..|:..||.|.:
  Fly   362 TSTQQAKCSNGHLTNRYD 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSNK1ENP_001885.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 163/273 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 301..416 24/109 (22%)
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 159/264 (60%)
SPS1 26..>266 CDD:223589 148/239 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100396
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.