DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSNK1E and CkIalpha

DIOPT Version :9

Sequence 1:NP_001885.1 Gene:CSNK1E / 1454 HGNCID:2453 Length:416 Species:Homo sapiens
Sequence 2:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster


Alignment Length:316 Identity:210/316 - (66%)
Similarity:254/316 - (80%) Gaps:7/316 - (2%)


- Green bases have known domain annotations that are detailed below.


Human     2 ELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIP 66
            |:.||.|||:.||||||||||||||.:|.||||||||:|....:||||..|:|.|:::.||||.|
  Fly    13 EIIVGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVGFP 77

Human    67 SIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKP 131
            .|:..|.|.::|.:||:|||||||||||||:|.|::||||:|.||||.|:||||.|.|||||:||
  Fly    78 RIRHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKP 142

Human   132 DNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDL 196
            ||||||:|:..|.:::||||||||:||..|..||.|||:|||||||||||||.|||||||||||:
  Fly   143 DNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLGIEQSRRDDM 207

Human   197 ESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYLNFCRSLRFD 261
            ||||||:||||.|.|||||:||.||:||||:||||||||||||||||.|:|||.|||:||||||:
  Fly   208 ESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNYCRSLRFE 272

Human   262 DKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLK---FGAARNP----EDVDRERRE 310
            ::|||.|||||||.||......|||::||.|||   .....||    |.:|:::.:
  Fly   273 EQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQKTHQGQPNPAILLEQLDKDKEK 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSNK1ENP_001885.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 195/273 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 301..416 3/14 (21%)
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 190/264 (72%)
Pkinase_Tyr 23..284 CDD:285015 187/260 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100396
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3408
SonicParanoid 1 1.000 - - X224
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.