DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gcm1 and gcm

DIOPT Version :9

Sequence 1:NP_032129.2 Gene:Gcm1 / 14531 MGIID:108045 Length:436 Species:Mus musculus
Sequence 2:NP_001260292.1 Gene:gcm / 34277 FlyBaseID:FBgn0014179 Length:504 Species:Drosophila melanogaster


Alignment Length:496 Identity:157/496 - (31%)
Similarity:206/496 - (41%) Gaps:147/496 - (29%)


- Green bases have known domain annotations that are detailed below.


Mouse    14 LSWDINDVKLPQNVKTTDWFQEWPDSYVKHIYSSDDRNAQRHLSSWAMRNTNNHNSRILKKSCLG 78
            :.|||||.|:| :|...|.|.:|.:.:.:.|||.....|::|.|.||||||||||..||||||||
  Fly    32 IDWDINDSKMP-SVGEFDDFNDWSNGHCRLIYSVQSDEARKHASGWAMRNTNNHNVNILKKSCLG 95

Mouse    79 VVVCSRDCSTEEGRKIYLRPAICDKARQKQQRKSCP--NCNGPLKLIPCRGHGGFPVTNFWRHDG 141
            |::||..|....|..::||||||||||:|||.|.||  ||||.|::..||||.|:|||:|||.||
  Fly    96 VLLCSAKCKLPNGASVHLRPAICDKARRKQQGKQCPNRNCNGRLEIQACRGHCGYPVTHFWRRDG 160

Mouse   142 RFIFFQSKGEHDHPRPETKLEAEARRAM------------------------------------- 169
            ..|:||:||.|||||||.|...||||.:                                     
  Fly   161 NGIYFQAKGTHDHPRPEAKGSTEARRLLAGGRRVRSLAVMLARESALSDKLSSLRPTKRQAKTQS 225

Mouse   170 ---KKVHMASASNSLRMKGR---PAAKALPAEIPS----------------QGSLPLTWS----- 207
               .|.....||:.|..|..   |....||...|:                |||:...|:     
  Fly   226 IQESKRRRMGASDVLETKQELVVPPTTYLPTSTPTHSTNFNQSQGSYVPAGQGSVISQWNREIHY 290

Mouse   208 -FQEGVQLPGTYS-----TPLIA----------NAPQ-------QNSLNDCLSFPKSYDLGGSTE 249
             .::.....|.||     :||.|          |.||       |..|:.....|.||       
  Fly   291 ETEDPCYANGMYSYDMLHSPLSAHSSTGSYYQENKPQQLQHSQYQQQLSPQQHVPVSY------- 348

Mouse   250 LEDPTSTLDS-----MKFYERC----KFSSSRIYGSEEQFQPPVPGTYGDYEDLQTWNKNVALG- 304
              ||:..:.|     |..||.|    ..:||..|.||:         ||.|......:.:|:.| 
  Fly   349 --DPSQPISSSLQCGMPSYEICDDTSSLTSSSGYCSED---------YGYYNGYLPNSLDVSNGS 402

Mouse   305 --RNPSDDIYYPAYPLPVASWPYDYFPS------QNSLEHLPQQVPSEPPAAQPGCHPLWSNPGG 361
              :|.|.|..:    ...:|..:..|.|      .:.::.:..:..:.....|.|..|..:|...
  Fly   403 QSQNLSQDASF----YTTSSEIFSVFESTLNGGGTSGVDLIYDEATAYQQHQQQGTFPHLTNYQQ 463

Mouse   362 EPYEEKVSVDLSSYVPS-------------LTYHPPQQ-DP 388
            ||.::..|.|   |..|             .||||... ||
  Fly   464 EPQDQMQSAD---YYYSNTGVDNSWNIQMDATYHPVNSTDP 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gcm1NP_032129.2 GCM 30..167 CDD:281598 81/138 (59%)
gcmNP_001260292.1 GCM 47..186 CDD:281598 81/138 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836026
Domainoid 1 1.000 201 1.000 Domainoid score I3000
eggNOG 1 0.900 - - E1_28MJ9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003094
OrthoInspector 1 1.000 - - mtm8784
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12414
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4583
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.