DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSNK1D and ball

DIOPT Version :9

Sequence 1:XP_005256393.1 Gene:CSNK1D / 1453 HGNCID:2452 Length:450 Species:Homo sapiens
Sequence 2:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster


Alignment Length:471 Identity:122/471 - (25%)
Similarity:184/471 - (39%) Gaps:91/471 - (19%)


- Green bases have known domain annotations that are detailed below.


Human     8 RYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIY----------KMMQ-- 60
            ::|:|..||.|.||:||....:......|: ::|....:..|.:|...|          :.||  
  Fly    46 QWRIGPSIGVGGFGEIYAACKVGEKNYDAV-VKCEPHGNGPLFVEMHFYLRNAKLEDIKQFMQKH 109

Human    61 --GGVGIPTIRWCGA---EGD-YNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYI 119
              ..:|:|.|...|:   .|: :..:||...|..|........::....||..||.||:...:|:
  Fly   110 GLKSLGMPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQNGKRLPEGTVYRLAIQMLDVYQYM 174

Human   120 HSKNFIHRDVKPDNFLMGLGKKGNL-VYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASIN 183
            ||..::|.|:|..|.|:||.|.|.. .|::|||||..:   .|....| ...|...||..|.|.:
  Fly   175 HSNGYVHADLKAANILLGLEKGGAAQAYLVDFGLASHF---VTGDFKP-DPKKMHNGTIEYTSRD 235

Human   184 THLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL----CKGY 244
            .|||: .:||.|||.|||.|:.:....|||...|......|.::..|..|....|.|    .||.
  Fly   236 AHLGV-PTRRADLEILGYNLIEWLGAELPWVTQKLLAVPPKVQKAKEAFMDNIGESLKTLFPKGV 299

Human   245 PSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDW----------NMLKFGASR 299
            |.....::.:...|..:.:|||...|..|.:...:.....:...|:          |:...|.|:
  Fly   300 PPPIGDFMKYVSKLTHNQEPDYDKCRSWFSSALKQLKIPNNGDLDFKMKPQTSSNNNLSPPGTSK 364

Human   300 AADDAERERRD-------------------REERLRHSRNPATRGLPSTASGRLRGTQEVAPPTP 345
            ||...:.::.|                   .||...|.:..|.:..||..:.::...:.||..:|
  Fly   365 AATARKAKKIDSPVLNSSLDEKISASEDDEEEEEKSHRKKTAKKVTPSARNAKVSPLKRVADSSP 429

Human   346 -----------LTPTSH-TANTSPRPVSGMERERK----VSMRLHR-GAPVNISSS-DLTGRQDT 392
                       .||... |...||:|.|..:...|    .:.||.. .|.:|.|.| .|.||   
  Fly   430 PSQKRVKTEPKSTPRERATPKASPKPRSTPKASPKPQTPTAARLRTPNAKINFSPSISLRGR--- 491

Human   393 SRMSTSQVGAELPGGR 408
                        |||:
  Fly   492 ------------PGGK 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSNK1DXP_005256393.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 86/296 (29%)
TyrKc 10..273 CDD:197581 85/285 (30%)
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 85/287 (30%)
SPS1 47..432 CDD:223589 102/390 (26%)
Pol_alpha_B_N <399..>502 CDD:285602 27/112 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.