DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RDH12 and CG11200

DIOPT Version :10

Sequence 1:NP_689656.2 Gene:RDH12 / 145226 HGNCID:19977 Length:316 Species:Homo sapiens
Sequence 2:NP_611471.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster


Alignment Length:111 Identity:21/111 - (18%)
Similarity:39/111 - (35%) Gaps:10/111 - (9%)


- Green bases have known domain annotations that are detailed below.


Human   756 GDDQKSPGKGVTSPLHTDTEKEAISPGRSVEPSAEEKSLISDKTAEWIAEEEDDVFVASRTTEDL 820
            |||:....|      ..:.|:|.....|..|...:||....::..|.:.:|..|.:...:..|.:
  Fly    16 GDDENDKEK------EEEAERERQEAIREAEERRKEKHRKMEEEREKMRQEIRDKYNIKKKEEIV 74

Human   821 FTVIHRSKRKLLGWKETGEGFTGSKP----SSHSPVKNTADSPTGE 862
            ..........|:..|:|.|.......    ...:.:||:.::...|
  Fly    75 EQAPQEEPNPLMRKKKTPEELAAEAEQEDLDDFTKLKNSIETQVNE 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RDH12NP_689656.2 retinol-DH_like_SDR_c 39..307 CDD:212495
CG11200NP_611471.1 Rossmann-fold NAD(P)(+)-binding proteins 67..338 CDD:473865 8/54 (15%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.