DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSNK1A1 and Asator

DIOPT Version :9

Sequence 1:NP_001020276.1 Gene:CSNK1A1 / 1452 HGNCID:2451 Length:365 Species:Homo sapiens
Sequence 2:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster


Alignment Length:334 Identity:105/334 - (31%)
Similarity:157/334 - (47%) Gaps:57/334 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    12 IVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQ--LLYESKLYKILQGGVGIP 74
            :|..::|:|||||.|.||:||...::...|:||:|:||  ||.|:  |..|..:.|.|||...:.
  Fly   168 VVKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVES--ARQPKQVLKMEVAVLKKLQGKEHVC 230

Human    75 HIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRR------FTMKTVLMLADQMISRIEYVHTKNFI 133
            .....|:...:|.:||.|.|.:|.:|     ||      |::.|.|.|..|::..||.:|:..|:
  Fly   231 RFIGCGRNDRFNYVVMQLQGKNLAEL-----RRAQPRGAFSLSTTLRLGLQILKAIESIHSVGFL 290

Human   134 HRDIKPDNFLMGIGRHCNKCLESPVGKRKRSMTVSTSQDPSFSGLNQLFLIDFGLAKKYRDNRTR 198
            ||||||.||  .:||....|                         .:::::|||||::|......
  Fly   291 HRDIKPSNF--SVGRLPYNC-------------------------RRVYMLDFGLARQYTTGTGE 328

Human   199 QHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLK----AATKKQ 259
            ...| |......||.||||||||...|..|.||:.||.|:|:.|....|||:.:|    ....|:
  Fly   329 VRCP-RAAAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVNGQLPWRKIKDKEQVGLTKE 392

Human   260 KYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTF 324
            ||:.          .:|.|..|::...:|.:.:.|.:.:.|||..|..||....:....:....:
  Fly   393 KYDH----------RILLKHLPSDLKQFLEHIQSLTYGDRPDYAMLIGLFERCMKRRGVKESDPY 447

Human   325 DWTMLKQKA 333
            ||..:...|
  Fly   448 DWEKVDSTA 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSNK1A1NP_001020276.1 STKc_CK1_alpha 16..309 CDD:271030 99/304 (33%)
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 100/305 (33%)
S_TKc 173..414 CDD:214567 94/285 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.