DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSNK1A1 and ball

DIOPT Version :9

Sequence 1:NP_001020276.1 Gene:CSNK1A1 / 1452 HGNCID:2451 Length:365 Species:Homo sapiens
Sequence 2:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster


Alignment Length:377 Identity:100/377 - (26%)
Similarity:147/377 - (38%) Gaps:71/377 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    15 GKYKLVRKIGSGSFGDIYLAINITNGE---EVAVKLESQKARHPQL------LYESKLYKILQ-- 68
            |::::...||.|.||:||.|..:  ||   :..||.|.. ...|..      |..:||..|.|  
  Fly    45 GQWRIGPSIGVGGFGEIYAACKV--GEKNYDAVVKCEPH-GNGPLFVEMHFYLRNAKLEDIKQFM 106

Human    69 -----GGVGIPHIRWYGQ-----EKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISR 123
                 ..:|:|:|...|.     || :..:||...|..|........:|....||..||.||:..
  Fly   107 QKHGLKSLGMPYILANGSVEVNGEK-HRFIVMPRYGSDLTKFLEQNGKRLPEGTVYRLAIQMLDV 170

Human   124 IEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSMTVSTSQDPSFSGLNQLFLIDFGL 188
            .:|:|:..::|.|:|..|.|:|:.:                           .|..|.:|:||||
  Fly   171 YQYMHSNGYVHADLKAANILLGLEK---------------------------GGAAQAYLVDFGL 208

Human   189 AK-----KYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLP 248
            |.     .::.:..:.|         .||..|.|.:||||: .:||.|:|.|||.|:.:....||
  Fly   209 ASHFVTGDFKPDPKKMH---------NGTIEYTSRDAHLGV-PTRRADLEILGYNLIEWLGAELP 263

Human   249 WQGLKAATKKQKYEKISEKKMSTPVEVL----CKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLF 309
            |...|......|.:|..|..|....|.|    .||.|.....::.|...|...:.|||...|..|
  Fly   264 WVTQKLLAVPPKVQKAKEAFMDNIGESLKTLFPKGVPPPIGDFMKYVSKLTHNQEPDYDKCRSWF 328

Human   310 RILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSN 361
            ....:.|....:...|:.|..|.::....|..|..:.|.....|:.|....|
  Fly   329 SSALKQLKIPNNGDLDFKMKPQTSSNNNLSPPGTSKAATARKAKKIDSPVLN 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSNK1A1NP_001020276.1 STKc_CK1_alpha 16..309 CDD:271030 88/322 (27%)
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 89/323 (28%)
SPS1 47..432 CDD:223589 99/375 (26%)
Pol_alpha_B_N <399..>502 CDD:285602
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.