DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSNK1A1 and CkIalpha

DIOPT Version :9

Sequence 1:NP_001020276.1 Gene:CSNK1A1 / 1452 HGNCID:2451 Length:365 Species:Homo sapiens
Sequence 2:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster


Alignment Length:358 Identity:253/358 - (70%)
Similarity:281/358 - (78%) Gaps:36/358 - (10%)


- Green bases have known domain annotations that are detailed below.


Human     7 SKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGV 71
            |:.|.||||||:::|||||||||||||.::|.:|||||:|:||..|||||||||:|||:||.|||
  Fly    10 SRPEIIVGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGV 74

Human    72 GIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRD 136
            |.|.||.:|:||::|.|||||||||||||||||:|.||:||||||.||||.|:||:|.|.|||||
  Fly    75 GFPRIRHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRD 139

Human   137 IKPDNFLMGIGRHCNKCLESPVGKRKRSMTVSTSQDPSFSGLNQLFLIDFGLAKKYRDNRTRQHI 201
            ||||||||||||||||                            |||||||||||:||..||.||
  Fly   140 IKPDNFLMGIGRHCNK----------------------------LFLIDFGLAKKFRDPHTRHHI 176

Human   202 PYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISE 266
            .||||||||||||||||||||||||||||||||||||:|||||..|||||:||.||:||||||||
  Fly   177 VYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISE 241

Human   267 KKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQ 331
            ||||||:||||||.||||:|||||||.|||||.|||||||||||||||||||||||.:|||||||
  Fly   242 KKMSTPIEVLCKGSPAEFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQ 306

Human   332 KAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKG 364
            |        :.|||.......:|.||.|....|
  Fly   307 K--------THQGQPNPAILLEQLDKDKEKQNG 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSNK1A1NP_001020276.1 STKc_CK1_alpha 16..309 CDD:271030 216/292 (74%)
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 216/292 (74%)
Pkinase_Tyr 23..284 CDD:285015 214/288 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159352
Domainoid 1 1.000 372 1.000 Domainoid score I901
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H111694
Inparanoid 1 1.050 522 1.000 Inparanoid score I1265
Isobase 1 0.950 - 0 Normalized mean entropy S180
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 1 1.000 - - otm40947
orthoMCL 1 0.900 - - OOG6_100396
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3408
SonicParanoid 1 1.000 - - X224
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1514.890

Return to query results.
Submit another query.