DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gbx2 and Ubx

DIOPT Version :9

Sequence 1:NP_034392.1 Gene:Gbx2 / 14472 MGIID:95668 Length:348 Species:Mus musculus
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:206 Identity:63/206 - (30%)
Similarity:87/206 - (42%) Gaps:46/206 - (22%)


- Green bases have known domain annotations that are detailed below.


Mouse   134 GGGNFDKAEALQADAEDGKAFLAKEGSLLAFSAAEAVQASLVG-----------AVRGQGKDESK 187
            |.||....::....|..|.|:.|  ...::.:||:...||.:.           |:.|:..    
  Fly   192 GNGNAGGVQSGVGVAGAGTAWNA--NCTISGAAAQTAAASSLHQASNHTFYPWMAIAGECP---- 250

Mouse   188 VEDDPKGKEESFSLESDVDYSSDDNLPGQTAHKEEDPGHALEETPQSGGAAGSTT-----STGKN 247
             ||..|.|     :.||:.         |......|.|....|:     .|||..     :.|..
  Fly   251 -EDPTKSK-----IRSDLT---------QYGGISTDMGKRYSES-----LAGSLLPDWLGTNGLR 295

Mouse   248 RRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKR----VKAG 308
            ||.|..:|..|.||||||||...||:...|.::||||.|:|.|:||||||||.|.|:    :|..
  Fly   296 RRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKEL 360

Mouse   309 NANSKTGEPSR 319
            |...|..:..:
  Fly   361 NEQEKQAQAQK 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gbx2NP_034392.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..81
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..139 3/4 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..251 17/76 (22%)
Homeobox 250..304 CDD:395001 30/53 (57%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 30/52 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.