DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gbx2 and ftz

DIOPT Version :9

Sequence 1:NP_034392.1 Gene:Gbx2 / 14472 MGIID:95668 Length:348 Species:Mus musculus
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:213 Identity:61/213 - (28%)
Similarity:78/213 - (36%) Gaps:78/213 - (36%)


- Green bases have known domain annotations that are detailed below.


Mouse   200 SLESDVDY--------------SSDDNLPGQTAHKEEDPGHALEETPQSGGAAGS---------- 240
            |...||||              :.|...|..|......|...:...|||.|...|          
  Fly   163 SASEDVDYLDVYSPQSQTQKLKNGDFATPPPTTPTSLPPLEGISTPPQSPGEKSSSAVSQEINHR 227

Mouse   241 --TTSTG------------------KNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALK 285
              |...|                  .::|.|..:|..|.||||||||..:|::...|..||:||.
  Fly   228 IVTAPNGAGDFNWSHIEETLASDCKDSKRTRQTYTRYQTLELEKEFHFNRYITRRRRIDIANALS 292

Mouse   286 LSEVQVKIWFQNRRAKWKRVK----------AG----------NANSKTGEPSRNPKIVVPIPVH 330
            |||.|:||||||||.|.|:.:          ||          .:.:.||.||      ||:|::
  Fly   293 LSERQIKIWFQNRRMKSKKDRTLDSSPEHCGAGYTAMLPPLEATSTATTGAPS------VPVPMY 351

Mouse   331 VSRFAIRSQHQQLEQARP 348
                    .|.|...|.|
  Fly   352 --------HHHQTTAAYP 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gbx2NP_034392.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..81
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..139
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..251 17/94 (18%)
Homeobox 250..304 CDD:395001 30/53 (57%)
ftzNP_477498.1 FTZ 1..248 CDD:281812 16/84 (19%)
Homeobox 257..310 CDD:278475 30/52 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.