DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHETA1 and Y37D8A.25

DIOPT Version :9

Sequence 1:NP_001171467.1 Gene:PHETA1 / 144717 HGNCID:26509 Length:262 Species:Homo sapiens
Sequence 2:NP_001022833.1 Gene:Y37D8A.25 / 3565405 WormBaseID:WBGene00012560 Length:141 Species:Caenorhabditis elegans


Alignment Length:130 Identity:37/130 - (28%)
Similarity:65/130 - (50%) Gaps:24/130 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    33 NAGFLYKKGGRHAAYHRR----------------WFVLRGNMLFYF---EDAASREPVGVIILEG 78
            ||..|::.|. ...:.||                |.||:.||||.:   |:..|..|..::|:|.
 Worm     4 NANSLFRLGS-DPTFERRFSGPLQLQQDFQWRAGWGVLKANMLFVYNKTEEETSAPPFLLLIIED 67

Human    79 CTVELVE---AAEEFAFAVRFAGTRARTYVLAAESQDAMEGWVKALSRASFDYLRLVVRELEQQL 140
            |.:||.:   ..::|.|.::|..| ||:::.||:|..::..||..|:.:..||::|..:...:|:
 Worm    68 CFIELCDENKIGKDFTFEIKFKST-ARSFIFAADSFKSLGRWVSLLTISPIDYIQLSKQSFHEQI 131

Human   141  140
             Worm   132  131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHETA1NP_001171467.1 PH_Ses 24..143 CDD:270105 37/130 (28%)
PH 35..125 CDD:278594 31/111 (28%)
Y37D8A.25NP_001022833.1 PH-like 31..133 CDD:388408 31/102 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I8688
eggNOG 1 0.900 - - E1_2CH2W
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003195
OrthoInspector 1 1.000 - - otm15324
orthoMCL 1 0.900 - - OOG6_106541
Panther 1 1.100 - - LDO PTHR22902
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.