DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43968 and Adgrf4

DIOPT Version :9

Sequence 1:NP_001262238.1 Gene:CG43968 / 14462915 FlyBaseID:FBgn0264699 Length:1026 Species:Drosophila melanogaster
Sequence 2:NP_001276428.1 Gene:Adgrf4 / 78249 MGIID:1925499 Length:698 Species:Mus musculus


Alignment Length:309 Identity:59/309 - (19%)
Similarity:103/309 - (33%) Gaps:96/309 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   785 GVSVYVSK-YILYFSIIPSIANVSGIALFANNNKKNTPTKLK--GAFKNEHYRFLQ--------- 837
            |:..|..: |:.....:.|.|..||...|.....||..:.|:  |...|.:::.::         
Mouse   133 GIQKYCPEDYVCIVDAVKSSAVTSGNIAFIVELLKNISSNLQTSGIHDNVNWKKMKNYGKVANHI 197

  Fly   838 ------------VNHNINDVVNEPDLELAAYLPIE-----LIDTLQAST---------------- 869
                        .|.|.:..:.|.....|..|.|:     ::|.|...|                
Mouse   198 LGPTAISNWAFIANKNASSDLLESVNSFAKKLQIQGKSESIVDELFIQTKGSRISHSSSEHSLSL 262

  Fly   870 -----NKTNDVIVVIKVYSNDELFQQSVRNLTL-LSRVVSISLPGYSSFL------------PV- 915
                 |.|.||:|||      |:.:|:::.|:. .|:.:.::.|...:.|            |: 
Mouse   263 SVPRYNATEDVLVVI------EIPRQALQELSFNASQAIVVAFPTLGAILKEVHRPNTNLQKPID 321

  Fly   916 -------------PVPLIFRKSKNKKVNPPGSCLVWN--YEGWIDGYSMLSYFENNEGIALCRLR 965
                         .:.|.|.|. ||..:....|:.|:  ...|.:  |..:...:......||.|
Mouse   322 DLILSLVLPEGLNEIILTFDKI-NKSQSTSSQCVSWDPATGQWDE--SPCTVMSDINSTVKCRCR 383

  Fly   966 RL-APTGY-FLEKKISIENHIINHDLRMSNTKLNGNIIYVILLSCCILM 1012
            .. |.|.: .|.....::|.|:||      ....|..|.:..|..|:::
Mouse   384 HTKAVTSFSILMSSKPVKNTILNH------ITFIGLSISIFSLVLCLVI 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43968NP_001262238.1 None
Adgrf4NP_001276428.1 GPS 351..394 CDD:366827 9/44 (20%)
7tm_GPCRs 402..669 CDD:391938 8/31 (26%)
TM helix 1 405..429 CDD:341315 6/28 (21%)
TM helix 2 444..465 CDD:341315
TM helix 3 479..501 CDD:341315
TM helix 4 522..538 CDD:341315
TM helix 5 560..583 CDD:341315
TM helix 6 606..631 CDD:341315
TM helix 7 636..661 CDD:341315
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.