Sequence 1: | NP_001262238.1 | Gene: | CG43968 / 14462915 | FlyBaseID: | FBgn0264699 | Length: | 1026 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001276428.1 | Gene: | Adgrf4 / 78249 | MGIID: | 1925499 | Length: | 698 | Species: | Mus musculus |
Alignment Length: | 309 | Identity: | 59/309 - (19%) |
---|---|---|---|
Similarity: | 103/309 - (33%) | Gaps: | 96/309 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 785 GVSVYVSK-YILYFSIIPSIANVSGIALFANNNKKNTPTKLK--GAFKNEHYRFLQ--------- 837
Fly 838 ------------VNHNINDVVNEPDLELAAYLPIE-----LIDTLQAST---------------- 869
Fly 870 -----NKTNDVIVVIKVYSNDELFQQSVRNLTL-LSRVVSISLPGYSSFL------------PV- 915
Fly 916 -------------PVPLIFRKSKNKKVNPPGSCLVWN--YEGWIDGYSMLSYFENNEGIALCRLR 965
Fly 966 RL-APTGY-FLEKKISIENHIINHDLRMSNTKLNGNIIYVILLSCCILM 1012 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG43968 | NP_001262238.1 | None | |||
Adgrf4 | NP_001276428.1 | GPS | 351..394 | CDD:366827 | 9/44 (20%) |
7tm_GPCRs | 402..669 | CDD:391938 | 8/31 (26%) | ||
TM helix 1 | 405..429 | CDD:341315 | 6/28 (21%) | ||
TM helix 2 | 444..465 | CDD:341315 | |||
TM helix 3 | 479..501 | CDD:341315 | |||
TM helix 4 | 522..538 | CDD:341315 | |||
TM helix 5 | 560..583 | CDD:341315 | |||
TM helix 6 | 606..631 | CDD:341315 | |||
TM helix 7 | 636..661 | CDD:341315 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4193 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |