DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43968 and ADGRL4

DIOPT Version :9

Sequence 1:NP_001262238.1 Gene:CG43968 / 14462915 FlyBaseID:FBgn0264699 Length:1026 Species:Drosophila melanogaster
Sequence 2:NP_071442.2 Gene:ADGRL4 / 64123 HGNCID:20822 Length:690 Species:Homo sapiens


Alignment Length:491 Identity:87/491 - (17%)
Similarity:165/491 - (33%) Gaps:132/491 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   572 CFSELSFSNDGMHLWWTTTRIGEIAMT---KKLCIQKDGMPYTRLCLGDFVHGAYWKKL--TQPV 631
            |:..:.||.:|:.:.......|.:..:   ...|...:|..|. :|:..|...:...:.  ....
Human    42 CYCNMGFSGNGVTICEDDNECGNLTQSCGENANCTNTEGSYYC-MCVPGFRSSSNQDRFITNDGT 105

  Fly   632 VCESPKNNTKVLHDLQVAKMFKSPPEKV------LKYLKDIIANSKNSIVPADIFLIYKIFQSVH 690
            ||....|....|.::.:|........|:      :..|:::..||...:.|.||....:|.....
Human   106 VCIENVNANCHLDNVCIAANINKTLTKIRSIKEPVALLQEVYRNSVTDLSPTDIITYIEILAESS 170

  Fly   691 EIHS------------SNSEFQQTTKDLTNW-KNAIYEIFD----------IYNVLIGLDSKVIK 732
            .:..            |||...:..|.:.|: :...:.::|          :..::..::...::
Human   171 SLLGYKNNTISAKDTLSNSTLTEFVKTVNNFVQRDTFVVWDKLSVNHRRTHLTKLMHTVEQATLR 235

  Fly   733 MSA--------ELNATNMFLKSFEMLFDTLSLNNLSFTQIDNGEEHLNDFNSETIDYDDIGVSVY 789
            :|.        :.|:|::.||.|  .||:.::.:: ...::...:::|.|......||..| :|.
Human   236 ISQSFQKTTEFDTNSTDIALKVF--FFDSYNMKHI-HPHMNMDGDYINIFPKRKAAYDSNG-NVA 296

  Fly   790 VSKYILYFSIIPSIANVSGIALFANNNKKNTPTKLKGAFKNEHYRFLQVNHNINDVVNEPDLELA 854
            |: ::.|.||.|.:::.....|...|                                       
Human   297 VA-FVYYKSIGPLLSSSDNFLLKPQN--------------------------------------- 321

  Fly   855 AYLPIELIDTLQASTNKTNDVIVVIKVYSNDELFQQSVRNLTLLSRVVSISLPGYSSFLPVPVPL 919
                                       |.|.|..::      ::|.|:|:|:......|.....:
Human   322 ---------------------------YDNSEEEER------VISSVISVSMSSNPPTLYELEKI 353

  Fly   920 IFRKSKNKKVNPPGS-CLVWNYE------GWIDGYSMLSYFENNEGIALCRLRRLAPTGYFLEKK 977
            .|..|..|..:...| |..|||.      .|......|:|  :||....||...|......:...
Human   354 TFTLSHRKVTDRYRSLCAFWNYSPDTMNGSWSSEGCELTY--SNETHTSCRCNHLTHFAILMSSG 416

  Fly   978 ISIENHIINHDLRMSNTKLNGNIIYVILLSCCILMF 1013
            .||  .|.::::....|:| |.||.:|.|:.||..|
Human   417 PSI--GIKDYNILTRITQL-GIIISLICLAICIFTF 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43968NP_001262238.1 None
ADGRL4NP_071442.2 EGF_CA 58..>91 CDD:284955 5/33 (15%)
GAIN 139..330 CDD:293098 37/261 (14%)
GPS 368..412 CDD:280071 13/45 (29%)
7tm_4 424..660 CDD:304433 10/27 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.