DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43968 and Adgrg3

DIOPT Version :9

Sequence 1:NP_001262238.1 Gene:CG43968 / 14462915 FlyBaseID:FBgn0264699 Length:1026 Species:Drosophila melanogaster
Sequence 2:NP_766624.3 Gene:Adgrg3 / 54672 MGIID:1859670 Length:542 Species:Mus musculus


Alignment Length:311 Identity:60/311 - (19%)
Similarity:112/311 - (36%) Gaps:101/311 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   751 FDTLSLNNLS--FTQID-----------------NGEEHLNDFNSETIDYDDI-----GVSVYVS 791
            :||..||:.:  ||:..                 |.|.:|.:.:.||:|...:     .:|..||
Mouse    38 YDTFDLNDTAQCFTKCGQSEHSPCDVGNLQRYWLNYESYLLENSMETVDMPFVKALIQNISTDVS 102

  Fly   792 KYILYFSIIPSIAN---------VSGIALFANNNKKNTPTKLKGAFKNEHYRFLQVNHNINDVVN 847
            :.:||..::..|..         ..|:.|         |..|.||.                   
Mouse   103 EDLLYSLMLSQIPRQVMQGEDEPADGVRL---------PKSLFGAL------------------- 139

  Fly   848 EPDLELAAYLPIELIDTLQASTNKTNDVIVVIKVYSNDELFQ---QSVRNLTLLSRVVSISL-PG 908
             |....|..|.|.::|            |....|:...:|.:   .||.|    :|:|.:|: ..
Mouse   140 -PGNRSAVRLAITVLD------------IGAGNVFKGPKLLEDKGSSVLN----NRMVGLSVGQM 187

  Fly   909 YSSFLPVPVPLIFRKSKNKKVNPPG---SCLVWNY-EGWIDGYSMLSYFENNEGIALCRLRRLAP 969
            :::.|..||.:.|...:    .||.   :|:.|:. :|..|.:...:.  ..:|..:||...|..
Mouse   188 HATGLSEPVEITFSHER----QPPNVILTCVFWDMAKGDWDSHGCSTV--PGDGRTVCRCDHLTF 246

  Fly   970 TGYFLEKKISIENHIINHDLRMSNTKLN--GNIIYVILLSCCILMFIGFLF 1018
            ....|..       |::.....:.|:::  |:.:.:|.|:..:::::.|.|
Mouse   247 FALLLRP-------ILDLATAQTLTRISQAGSAVSMIFLAFTMVLYVAFRF 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43968NP_001262238.1 None
Adgrg3NP_766624.3 GPS 211..250 CDD:280071 8/40 (20%)
7tm_4 262..509 CDD:304433 6/29 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.