DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43968 and mthl5

DIOPT Version :9

Sequence 1:NP_001262238.1 Gene:CG43968 / 14462915 FlyBaseID:FBgn0264699 Length:1026 Species:Drosophila melanogaster
Sequence 2:NP_001287291.1 Gene:mthl5 / 41438 FlyBaseID:FBgn0037960 Length:497 Species:Drosophila melanogaster


Alignment Length:430 Identity:82/430 - (19%)
Similarity:151/430 - (35%) Gaps:118/430 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 LIHLQNNPNEHCLKHTINNQTPADFKSQIVSVDCNAFLNAVCIFKSELISNAGCPSGFGALVYQP 250
            |.|..|..||...:|.|.:....|....:..:..:......||.|:  .|:.|..:     |...
  Fly   139 LRHYTNAENEAEERHGIQSDYEEDIAGSLEPLYHDYDKGLYCIDKA--TSSTGEEN-----VLFA 196

  Fly   251 AVCYG---IDWNNTTYEPLDLKEYLKKRNWLRRILAKYVLKKNRHEFFKIDFFIHHSTKMEYVIK 312
            .:|..   |.|:::.:             .||:||..                |.|...:  ||.
  Fly   197 NICLARKEIKWSDSNF-------------LLRKILNP----------------IFHGISL--VIL 230

  Fly   313 MSLSEDFQIVSKGLKWIPTLSKQIVKS-SSAVEMVLEIDHRSKGVRLVIYNRKYLWKNNNSYVG- 375
            :.::..:.|       :||||:.:|.: .:.:.|.|.:...:..||        ::....|:|. 
  Fly   231 LVIAIIYFI-------LPTLSRDLVGNIVTTIAMCLMVSQAADLVR--------IFTELTSHVSF 280

  Fly   376 -----VKCFALLKYGTLKNVRLDLIWENQEQSYSILKVNIVSSYRTEYWCEGHSIFEFQLVST-- 433
                 :.||:||......|.....||:........|:|.....|     |. :|.:.:...:|  
  Fly   281 IVADIILCFSLLAAFFWLNSFGFYIWKTFRSRNVFLRVTDGRKY-----CY-YSAYAWGCTATMA 339

  Fly   434 ------RLFVDV-----NRSIAPVFVLRWNVSCINANFAYNLCDEVTD----KNLRKLI--ESVY 481
                  ..|:|.     ...:.....:.|...||  .||...|..:.:    ...||||  .:||
  Fly   340 ALAVFAHFFLDAESYKQEHMVGEQETIGWLGICI--FFAPIACTILVNIFFYVTTRKLINRRTVY 402

  Fly   482 G---NNNLGNLLIYDVR--IMNIEWIKNMCVVFWIHITATLKSTASTYHKEIAFVDNTPRIPKDF 541
            |   :....|.:::.:.  :|:|.|:  ..::.|:.:...|      |...:.....||.:.  :
  Fly   403 GRIAHKLKANFIMFSLMLLVMSIAWL--FLIMSWLQMEGLL------YAHIVVNALQTPLLL--Y 457

  Fly   542 VAFMKVKITLSNFFLNFIKNSTYLLRSTDYCFSELSFSND 581
            :..::.            ::.|:||:.| .|::|...:||
  Fly   458 ICVLRQ------------RHVTFLLKKT-CCYNEPPSAND 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43968NP_001262238.1 None
mthl5NP_001287291.1 7tm_4 212..451 CDD:304433 55/300 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.