DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43968 and mthl7

DIOPT Version :9

Sequence 1:NP_001262238.1 Gene:CG43968 / 14462915 FlyBaseID:FBgn0264699 Length:1026 Species:Drosophila melanogaster
Sequence 2:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster


Alignment Length:518 Identity:80/518 - (15%)
Similarity:159/518 - (30%) Gaps:192/518 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 RRNDELMPYEVRLPGK-----SWRKEINRSLIHLQNNPNEHCLKHTINNQTPADFKSQIVSVDCN 220
            |:||..:..::.:|..     .:|:..:.|:     .|.|..|:..:.:..|.      :.:.|.
  Fly    40 RQNDSYLYDDIEIPASLTGYYEFRQFGDGSI-----TPIEKHLRACVCSVRPC------IRICCP 93

  Fly   221 AFLNAVCIFKSELISNAGCPSGFGALV--YQPAVCYGIDWNNTTYEPLDLKEYLKKRNWLRRILA 283
            |         ...::|..|..|....:  ::|.:.:       ||..|..:..|.....:     
  Fly    94 A---------KNFLANGKCDDGLKEELARFKPYIYF-------TYMDLQARVPLTDMAII----- 137

  Fly   284 KYVLKKNRHEFFKIDFFIHHSTKMEYVIKMSLSEDFQIVSK-GLKWIPTLSKQIVKSSSAVEMVL 347
                   |.|||..|..|:.|....::.::|:    ||.:| ||                     
  Fly   138 -------RDEFFDCDEMIYISDFNYFLEEVSI----QIFNKCGL--------------------- 170

  Fly   348 EIDHRSKGVRLVIYNRKYLWKNNNSYVGVKCFALLKYGTLKNVRLDLIWENQEQSYSILKVNIVS 412
                      :|.:.....|                      |.:||..|.|:  |.:.:.|..|
  Fly   171 ----------IVWFQDGKFW----------------------VTVDLFMEKQD--YCLYRHNFDS 201

  Fly   413 SYRTEYW-----CEGH---SIFEFQLVSTRLFV-----------------------DVNRSIAPV 446
            .:....|     |..|   ...|..:::...||                       .|:|.|..:
  Fly   202 DFPKSMWIIRHRCTSHISPGSLEILIITMICFVLTIAVYLYIKKLRNVTGKCIVCCIVSRFIQCL 266

  Fly   447 FVLRWNVSCINA------------NFAYNLCDEVTDKNLRKLIESVYGNNNLGNLLIYD------ 493
            .::..:::.:|.            ..|.||...|...:..|::.|:...:.....|.|:      
  Fly   267 IMILDHLNLLNGICSPAGYSSHFFRMASNLWLSVISYHTWKVLTSLNRVDPNYRFLRYNAFVWST 331

  Fly   494 -------VRIMNIEWIKNMCVVFWIHITATLKSTASTYHKEIAFVDNTPRIPKD----------F 541
                   :.|:|..|..:.....|:.:...::.:...:|..:....:.|.:...          .
  Fly   332 AAIMTGSIYIVNQIWENDPSKWNWLPLVGFIRCSVKDWHPSVWIYISGPSLALSTFNVAMFALTA 396

  Fly   542 VAFMKVK-------------ITLSNF----FLNFIKNSTYLLRSTDYCFSELSFSNDGMHLWW 587
            :...|||             |...||    :|.|::.|  ::....:.|:.:.:| ..:|::|
  Fly   397 IYIRKVKGGINKFTNEEEGRINCINFDSQTYLQFLRLS--IVMGLTWIFNVIPYS-ARLHIFW 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43968NP_001262238.1 None
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804 44/271 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.