DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43968 and mthl2

DIOPT Version :9

Sequence 1:NP_001262238.1 Gene:CG43968 / 14462915 FlyBaseID:FBgn0264699 Length:1026 Species:Drosophila melanogaster
Sequence 2:NP_788462.2 Gene:mthl2 / 38636 FlyBaseID:FBgn0035623 Length:518 Species:Drosophila melanogaster


Alignment Length:335 Identity:59/335 - (17%)
Similarity:112/335 - (33%) Gaps:128/335 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   739 ATNMFLKSFEMLFDTLSLNNLSFTQIDNGEEHLNDFNSETID---YDDIGVS----VYVSKYILY 796
            ::.|.|.:..:::..|:|.:.|               :|..|   ||.:.:|    :....|:..
  Fly     4 SSKMLLSASILIYFLLNLQSSS---------------AEIADCSFYDTVDISEGQRLSNGSYLYE 53

  Fly   797 FSIIPSIANVSG---IALFANNNKKNTPTKLKGA---------FKNEHYRFLQVNHNINDVVNEP 849
            ..:||  |:::.   ..|.||.:|:..|:.::|.         |...|...:.:.....::..|.
  Fly    54 GLLIP--AHLTAKYEFKLLANGDKEQVPSHVRGCVCKLRTCVRFCCPHDHIMDMGECYANMTTEE 116

  Fly   850 DLELAAYLPIELIDTLQASTNKTNDVIVVIKVYSNDELFQQSVRNLTLLSRVVSISLPGYSSFLP 914
            :         ||:|.:...|  .:|..||.:.|..:.:.|..                     ||
  Fly   117 N---------ELLDPMLNVT--LDDGSVVQRHYKKELMVQWD---------------------LP 149

  Fly   915 VPVPLIFRKSKNKKVNPPGSCLVWNYEGWIDGYSMLSYFENNEGIALCRLRR------LAPTGYF 973
            .|...:|... |:.:              :|.|::   |||.      ||.|      |..:.|.
  Fly   150 KPCDDMFYLD-NRDI--------------MDEYTL---FENG------RLLRHYDQVYLDKSEYC 190

  Fly   974 LEKKISIENH-----IINHDLRMSNTKLNGNIIYVILLSCCIL---------------------- 1011
            |:.:...|.:     ||.|:..:..::....::.:..|.|.:|                      
  Fly   191 LQHRTFGEGNNNSIRIIPHNCLILPSRTGQTVVMITSLICLVLTIAVYLCVKKLMNLEGKCFICY 255

  Fly  1012 ---MFIGFLF 1018
               :|.|:||
  Fly   256 MMCLFFGYLF 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43968NP_001262238.1 None
mthl2NP_788462.2 Methuselah_N 31..211 CDD:284145 45/237 (19%)
7tm_4 221..>395 CDD:304433 7/45 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.