DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43968 and Cirl

DIOPT Version :9

Sequence 1:NP_001262238.1 Gene:CG43968 / 14462915 FlyBaseID:FBgn0264699 Length:1026 Species:Drosophila melanogaster
Sequence 2:NP_001260807.1 Gene:Cirl / 35846 FlyBaseID:FBgn0033313 Length:1711 Species:Drosophila melanogaster


Alignment Length:516 Identity:102/516 - (19%)
Similarity:189/516 - (36%) Gaps:142/516 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   584 HLWWTTTRIGEIAMTKKLCIQKDGMPYTRLCLGDFVHGAYWKKLTQPVVCESPKNNTKVLHDLQV 648
            :|:|..||:|::.:              :.|.|.....|.|:.:....:.:|..:.    :|..:
  Fly   337 NLYWNMTRVGDVNV--------------QPCPGGAAGIAKWRCVLMKRIPDSGYDE----YDDDI 383

  Fly   649 AKMFKSPPEKVLKYLKDIIANSKNSIVPADIFLIYKIFQSVHEIHSSNSEFQQT----TKDLTN- 708
            :....:|..      .|.:.||.:...|..:         .|:::.....|:.|    |.|||. 
  Fly   384 SSTTPAPSG------GDCLHNSSSCEPPVSM---------AHKVNQRLRNFEPTWHPATPDLTQC 433

  Fly   709 ---WKNAIYEIFDIYNVLIGL---DSKVIKMSAELN--ATNMFLKSFEMLFDTLSLNNLSFTQID 765
               |.|         |:.:.:   ||.:|.::.:::  .::..|...:||..|..:..:|...:.
  Fly   434 RSLWLN---------NLEMRVNQRDSSLISIANDMSEVTSSKTLYGGDMLVTTKIIQTVSEKMMH 489

  Fly   766 NGEEHLNDFNSETIDYDDIGVSVYVSKYILYFSIIPS-----------IAN--VSGIA----LFA 813
            :.|...:....|.:..:.:...|.....:|..|.:.|           :|.  ::|:.    |.|
  Fly   490 DKETFPDQRQREAMIMELLHCVVKTGSNLLDESQLSSWLDLNPEDQMRVATSLLTGLEYNAFLLA 554

  Fly   814 NN--NKKNTPTKLKGAFKNEHYRFLQVNHNINDVVNEPD----------LEL------------- 853
            :.  .:::...|:|....:  .|.|:.. .|...|..||          :||             
  Fly   555 DTIIRERSVVQKVKNILLS--VRVLETK-TIQSSVVFPDSDQWPLSSDRIELPRAALIDNSEGGL 616

  Fly   854 -----AAYLPIELI-------DTLQASTNKTNDVIVVIKVYSNDE-----LFQQSVRNLTLLSRV 901
                 ||:..:|.|       ..|::|.:...:..::    |||.     ..||.:|.|.  |:|
  Fly   617 VRIVFAAFDRLESILKPSYDHFDLKSSRSYVRNTAIL----SNDSDVNAGEIQQRLRILN--SKV 675

  Fly   902 VSISL-PGYSSFLPVPVPLIFRKSKNKKVNPPGSCLVWNY--EGW-IDGYSMLSYFENNEGIALC 962
            :|.|| .|....|..|:.|..:..|.:.|..| :|:.|||  ..| .:|.|:.|   .|...::|
  Fly   676 ISASLGKGRHIQLSQPITLTLKHLKTENVTNP-TCVFWNYIDHAWSANGCSLES---TNRTHSVC 736

  Fly   963 RLRRLAPTGYFLEKKISIENHIINHDLRMSNTKLNGNI---IYVILLSCCILMFIGFLFCK 1020
            ....|......::   .::.|  .|.|   .|..:||:   ||:.:..|.:.:.|..|..|
  Fly   737 SCNHLTNFAILMD---VVDEH--QHSL---FTMFDGNMRIFIYISIGICVVFIVIALLTLK 789

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43968NP_001262238.1 None
CirlNP_001260807.1 Gal_Lectin 33..113 CDD:280328
GAIN 453..680 CDD:293098 42/235 (18%)
GPS 705..752 CDD:197639 12/53 (23%)
7tm_4 763..1014 CDD:304433 8/27 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.