DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43968 and adgrg1

DIOPT Version :9

Sequence 1:NP_001262238.1 Gene:CG43968 / 14462915 FlyBaseID:FBgn0264699 Length:1026 Species:Drosophila melanogaster
Sequence 2:NP_001018317.1 Gene:adgrg1 / 324948 ZFINID:ZDB-GENE-030131-3671 Length:648 Species:Danio rerio


Alignment Length:181 Identity:44/181 - (24%)
Similarity:68/181 - (37%) Gaps:39/181 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   854 AAYLPIELIDTLQASTNKTNDVIVVIKVYSNDELFQQSVRNLTLLSRVVSISLPGYS-SFLPVPV 917
            :.|:|..|   ...|..|:.   ||...|.|..||::......||..:|.:|:...: ..|..||
Zfish   238 SVYIPSSL---RSVSRRKSK---VVCTYYKNKTLFERGPSKSALLDDIVGLSVENETIRNLIEPV 296

  Fly   918 PLIFRKSKNKKVNP--PGSCLVW-----NYEGW-IDGYSMLSYFENNEGIALCRLRRLAPTGYF- 973
            .:.|.   ::...|  .|.|:.|     |...| .||...:..   ||....|....|.   || 
Zfish   297 KIRFH---HRPFAPDSSGRCVSWDTKQDNEVNWKDDGCDTVKI---NEEQTECHCNHLT---YFA 352

  Fly   974 ----LEKKISIENHIINHDLRMSNTKLNGNIIYVILLSCCILMFIGFLFCK 1020
                :|:|.:: .|:      .:.|.:......|.|:||.:|.   :..||
Zfish   353 ILVQVEQKSTV-RHL------KALTFITAVGCAVSLVSCLVLF---YWLCK 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43968NP_001262238.1 None
adgrg1NP_001018317.1 GPS 312..354 CDD:280071 12/47 (26%)
7tm_4 369..611 CDD:304433 8/28 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.