DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43968 and Adgrg3

DIOPT Version :9

Sequence 1:NP_001262238.1 Gene:CG43968 / 14462915 FlyBaseID:FBgn0264699 Length:1026 Species:Drosophila melanogaster
Sequence 2:XP_038954076.1 Gene:Adgrg3 / 291854 RGDID:1305674 Length:574 Species:Rattus norvegicus


Alignment Length:320 Identity:60/320 - (18%)
Similarity:122/320 - (38%) Gaps:82/320 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   714 YEIFDIYNVLIGLDSKVIKMSAELNATNMFLKSFEMLFDTLSLNNLSFTQIDNGEEHLNDFNSET 778
            |..||:.::                 ...|.|..:...::..:.||....: |.|.||.:.:.||
  Rat    70 YNTFDLSDI-----------------AQCFTKCGQSDTNSCEVGNLQRYWL-NYESHLLENSMET 116

  Fly   779 IDYDDI-----GVSVYVSKYILYFSIIPSIANVSGIALFANNNKKNTPTKLKGAFKNEHYRFLQV 838
            :|...:     .:|..||:.:|| |::||                                  |:
  Rat   117 VDMPFVKALIQNISTDVSEDLLY-SLVPS----------------------------------QI 146

  Fly   839 NHNINDVVNEPDLELAAYLPIELIDTLQASTNKTNDVIVVI-----KVYSNDELFQ---QSVRNL 895
            ...:....::|...:.  ||..|...|..:.:.....|.::     .|:....|.:   .||.| 
  Rat   147 PRQVMRGEDQPADRVR--LPKSLFGALPGNRSAVRLAITILNIGPGNVFKGPRLLEDKGSSVLN- 208

  Fly   896 TLLSRVVSISL-PGYSSFLPVPVPLIFRKSKNKKVNPPGSCLVWNY-EGWIDGYSMLSYFENNEG 958
               :|:|.:|: ..:::.|..||.:.| ..:::..|...:|:.|:. :|..|.:...:  |..:|
  Rat   209 ---NRMVGLSVGQMHATGLSEPVEITF-SHQHQSPNVILTCVFWDMAKGDWDSHGCST--EPGDG 267

  Fly   959 IALCRLRRLAPTGYFLEKKISIENHIINHDLRMSNTKLNGNIIYVILLSCCILMFIGFLF 1018
            ..:||...|  |.:.|..:.:::........|:|..   |:.:.:|.|:..:::::.|.|
  Rat   268 RTVCRCDHL--TFFALLLRPTLDQATARTLTRISQA---GSAVSMIFLAFTMVLYVAFRF 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43968NP_001262238.1 None
Adgrg3XP_038954076.1 GPS 244..282 CDD:396408 10/41 (24%)
7tm_GPCRs 292..551 CDD:421689 7/34 (21%)
TM helix 1 294..319 CDD:410628 5/27 (19%)
TM helix 2 333..355 CDD:410628
TM helix 3 366..393 CDD:410628
TM helix 4 406..426 CDD:410628
TM helix 5 454..481 CDD:410628
TM helix 6 495..522 CDD:410628
TM helix 7 524..549 CDD:410628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.